2. Recombinant Proteins
  3. Enzymes & Regulators
  4. Transferases (EC 2)
  5. SULT4A1 Protein, Human

SULT4A1 Protein, Human

Cat. No.: HY-P71344
Handling Instructions

SULT4A1 Protein, an atypical sulfotransferase, shows low PAPS affinity and minimal catalytic activity toward substrates like L-triiodothyronine and estrone. Despite limited efficiency, SULT4A1 may impact drug and neurotransmitter metabolism in the central nervous system (CNS). SULT4A1 Protein, Human is the recombinant human-derived SULT4A1 protein, expressed by E. coli , with tag free. The total length of SULT4A1 Protein, Human is 284 a.a., with molecular weight of ~34.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SULT4A1 Protein, an atypical sulfotransferase, shows low PAPS affinity and minimal catalytic activity toward substrates like L-triiodothyronine and estrone. Despite limited efficiency, SULT4A1 may impact drug and neurotransmitter metabolism in the central nervous system (CNS). SULT4A1 Protein, Human is the recombinant human-derived SULT4A1 protein, expressed by E. coli , with tag free. The total length of SULT4A1 Protein, Human is 284 a.a., with molecular weight of ~34.0 kDa.
Background

SULT4A1, a member of the atypical sulfotransferase family, exhibits notably low affinity for 3'-phospho-5'-adenylyl sulfate (PAPS) and displays minimal catalytic activity towards various substrates, including L-triiodothyronine, thyroxine, estrone, p-nitrophenol, 2-naphthylamine, and 2-beta-naphthol. Despite its limited catalytic efficiency, SULT4A1 may play a role in the metabolism of drugs and neurotransmitters within the central nervous system (CNS).
Species

Human
Source

E. coli
Tag

Tag Free
Accession

Q9BR01 (M1-L284)
Gene ID
Molecular Construction
N-term
SULT4A1 (M1-L284)
Accession # Q9BR01
C-term
Synonyms
Sulfotransferase 4A1; ST4A1; Brain Sulfotransferase-Like Protein; hBR-STL; hBR-STL-1; Nervous System Sulfotransferase; NST; SULT4A1; SULTX3
AA Sequence

MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCNAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL

Molecular Weight

Approximately 34.0 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

SULT4A1 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SULT4A1 Protein, Human
Cat. No.:
HY-P71344
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.