SWSAP1 Protein, Human (His)

SWSAP1, an ATPase selectively activated by single-stranded DNA, is vital for homologous recombination repair (HRR). In addition to ATPase activity, SWSAP1 independently binds DNA. Teaming up with ZSWIM7, it forms a complex crucial for HRR, with mutual stabilization. SWSAP1 interacts with key HRR proteins—RAD51, RAD51B, RAD51C, RAD51D, and XRCC3—underscoring its role in facilitating homologous recombination repair processes. SWSAP1 Protein, Human (His) is the recombinant human-derived SWSAP1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of SWSAP1 Protein, Human (His) is 229 a.a., with molecular weight of ~30.0 kDa.

The ATPase SWSAP1 is selectively stimulated by single-stranded DNA and plays a crucial role in homologous recombination repair (HRR). Apart from its ATPase activity, SWSAP1 exhibits an independent DNA-binding capability. It forms a functional complex with ZSWIM7, contributing to homologous recombination repair, and both proteins mutually stabilize each other. SWSAP1 further interacts with key proteins involved in HRR, including RAD51, RAD51B, RAD51C, RAD51D, and XRCC3, highlighting its involvement in facilitating homologous recombination repair processes.

Human

E. coli

N-6*His

Q6NVH7 (M1-P229)

126074  [NCBI]

MPAAGPPLLLLGTPGSGKTALLFAAALEAAGEGQGPVLFLTRRPLQSMPRGTGTTLDPMRLQKIRFQYPPSTRELFRLLCSAHEAPGPAPSLLLLDGLEEYLAEDPEPQEAAYLIALLLDTAAHFSHRLGPGRDCGLMVALQTQEEAGSGDVLHLALLQRYFPAQCWLQPDAPGPGEHGLRACLEPGGLGPRTEWWVTFRSDGEMMIAPWPTQAGDPSSGKGSSSGGQP

Approximately 30.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.