SWSAP1 Protein, Human (His)
Based on 1 Customer Validation
SWSAP1, an ATPase selectively activated by single-stranded DNA, is vital for homologous recombination repair (HRR). In addition to ATPase activity, SWSAP1 independently binds DNA. Teaming up with ZSWIM7, it forms a complex crucial for HRR, with mutual stabilization. SWSAP1 interacts with key HRR proteins—RAD51, RAD51B, RAD51C, RAD51D, and XRCC3—underscoring its role in facilitating homologous recombination repair processes. SWSAP1 Protein, Human (His) is the recombinant human-derived SWSAP1 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
SWSAP1, an ATPase selectively activated by single-stranded DNA, is vital for homologous recombination repair (HRR). In addition to ATPase activity, SWSAP1 independently binds DNA. Teaming up with ZSWIM7, it forms a complex crucial for HRR, with mutual stabilization. SWSAP1 interacts with key HRR proteins—RAD51, RAD51B, RAD51C, RAD51D, and XRCC3—underscoring its role in facilitating homologous recombination repair processes. SWSAP1 Protein, Human (His) is the recombinant human-derived SWSAP1 protein, expressed by E. coli , with N-6*His labeled tag.
The ATPase SWSAP1 is selectively stimulated by single-stranded DNA and plays a crucial role in homologous recombination repair (HRR). Apart from its ATPase activity, SWSAP1 exhibits an independent DNA-binding capability. It forms a functional complex with ZSWIM7, contributing to homologous recombination repair, and both proteins mutually stabilize each other. SWSAP1 further interacts with key proteins involved in HRR, including RAD51, RAD51B, RAD51C, RAD51D, and XRCC3, highlighting its involvement in facilitating homologous recombination repair processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q6NVH7 (M1-P229)
-
Gene ID126074 [NCBI]
-
Molecular Construction
-
N-term
-
6*His
-
SWSAP1 (M1-P229)
Accession # Q6NVH7 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
SWSAP1; Zinc Finger, SWIM-Type Containing 7 Associated Protein 1; Prev. C19orf39; ATPase SWSAP1; ZSWIM7AP1; FLJ35119; SWS1-Associated Protein 1; SWIM-Type Zinc Finger 7-Associated Protein 1; SWS1AP1; Chromosome 19 Open Reading Frame 39; SWIM-Type Zinc Fin
-
AA Sequence
MPAAGPPLLLLGTPGSGKTALLFAAALEAAGEGQGPVLFLTRRPLQSMPRGTGTTLDPMRLQKIRFQYPPSTRELFRLLCSAHEAPGPAPSLLLLDGLEEYLAEDPEPQEAAYLIALLLDTAAHFSHRLGPGRDCGLMVALQTQEEAGSGDVLHLALLQRYFPAQCWLQPDAPGPGEHGLRACLEPGGLGPRTEWWVTFRSDGEMMIAPWPTQAGDPSSGKGSSSGGQP
-
Predicted Molecular Mass
25.7 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, 1 mM EDTA, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
