Syntaxin-8 Protein, Human
Syntaxin-8 is a vesicular transport protein that promotes retrograde transport within the early secretory pathway. It is essential for homotypic fusion of late endosomes, forming a SNARE complex with STX7, VTI1B, and VAMP8. Syntaxin-8 Protein, Human is the recombinant human-derived Syntaxin-8 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Syntaxin-8 is a vesicular transport protein that promotes retrograde transport within the early secretory pathway. It is essential for homotypic fusion of late endosomes, forming a SNARE complex with STX7, VTI1B, and VAMP8. Syntaxin-8 Protein, Human is the recombinant human-derived Syntaxin-8 protein, expressed by E. coli , with tag free.
Background
Syntaxin-8, a vesicle trafficking protein, operates within the early secretory pathway, potentially facilitating retrograde transport from cis-Golgi membranes to the endoplasmic reticulum (ER). It plays a crucial role in homotypic fusion of late endosomes by forming a SNARE complex with STX7, VTI1B, and VAMP8. As a component of the SNARE core complex containing STX7, VAMP8, and VTI1B, Syntaxin-8 engages in intricate molecular interactions. It interacts with VAMP8, contributing to the coordination of vesicle fusion events. Additionally, Syntaxin-8 interacts with HECTD3 and TPC1, further highlighting its involvement in diverse cellular processes and emphasizing its significance in vesicle trafficking and membrane fusion events.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9UNK0 (M1-G215)
-
Molecular Construction
-
N-term
-
Syntaxin-8 (M1-G215)
Accession # Q9UNK0 -
C-term
-
-
Protein Length
Cytoplasmic Domain
-
Synonyms
STX8; CARB; Syntaxin 8; CIP-1-Associated Regulator Of Cyclin B; Syntaxin-8
-
AA Sequence
MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRNETRRVNMVDRKSASCG
-
Predicted Molecular Mass
24.6 kDa
-
Molecular Weight
Approximately 28 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
