1. Recombinant Proteins
  2. Others
  3. TAFA2/FAM19A2 Protein, Human (HEK293, Fc)

The FAM19A2 protein plays a key role as a neurotrophic factor, actively promoting neuronal survival and various neurobiological functions. Its involvement is shown to have a critical impact on the maintenance and health of neurons, underscoring its potential significance in supporting neurological health. TAFA2/FAM19A2 Protein, Human (HEK293, Fc) is the recombinant human-derived TAFA2/FAM19A2 protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

The FAM19A2 protein plays a key role as a neurotrophic factor, actively promoting neuronal survival and various neurobiological functions. Its involvement is shown to have a critical impact on the maintenance and health of neurons, underscoring its potential significance in supporting neurological health. TAFA2/FAM19A2 Protein, Human (HEK293, Fc) is the recombinant human-derived TAFA2/FAM19A2 protein, expressed by HEK293 , with N-hFc labeled tag.

Background

The FAM19A2 protein functions as a neurotrophic factor, playing a critical role in promoting neuronal survival and contributing to various neurobiological functions. Its involvement in supporting the well-being and persistence of neurons underscores its significance in maintaining proper neuronal health. The characterization of FAM19A2 as a neurotrophic factor suggests its potential relevance in neuroprotective strategies and the modulation of essential processes within the nervous system.

Species

Human

Source

HEK293

Tag

N-hFc

Accession

Q8N3H0-1 (A31-H131)

Gene ID
Molecular Construction
N-term
hFc
TAFA2 (A31-H131)
Accession # Q8N3H0-1
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Chemokine-like protein TAFA-2; TAFA-2; FAM19A2
AA Sequence

ANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH

Predicted Molecular Mass
36.7 kDa
Molecular Weight

Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE or Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

TAFA2/FAM19A2 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TAFA2/FAM19A2 Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TAFA2/FAM19A2 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P77221
Quantity:
MCE Japan Authorized Agent: