TAFA2/FAM19A2 Protein, Human

The FAM19A2 protein plays a key role as a neurotrophic factor, actively promoting neuronal survival and various neurobiological functions. Its involvement is shown to have a critical impact on the maintenance and health of neurons, underscoring its potential significance in supporting neurological health. TAFA2/FAM19A2 Protein, Human is the recombinant human-derived TAFA2/FAM19A2 protein, expressed by E. coli , with tag free. The total length of TAFA2/FAM19A2 Protein, Human is 101 a.a., with molecular weight of 11-15 kDa.

The FAM19A2 protein functions as a neurotrophic factor, playing a critical role in promoting neuronal survival and contributing to various neurobiological functions. Its involvement in supporting the well-being and persistence of neurons underscores its significance in maintaining proper neuronal health. The characterization of FAM19A2 as a neurotrophic factor suggests its potential relevance in neuroprotective strategies and the modulation of essential processes within the nervous system.

1. The biological activity is determined by its ability to enhance neurite outgrowth of E16-E18 rat embryonic cortical neurons. rHuTAFA-2; immobilized at 6-24 μg/mL on a 96 well plate; is able to significantly enhance neurite outgrowth.
2. Measured in a cell proliferation assay using SH-SY5Y human neuroblastoma cells. The ED₅₀ this effect is 1.455-3.659 μg/mL, corresponding to a specific activity is > 273.30 units/mg.

• 
  Measured in a cell proliferation assay using SH-SY5Y human neuroblastoma cells. The ED₅₀ for this effect is 3.659 μg/ml, corresponding to a specific activity is 273.30 units/mg.

Human

E. coli

Tag Free

Q8N3H0 (A31-H131)

338811  [NCBI]

ANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH

11-15 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 2 × PBS, pH 7.4 or 40 mM PB, 300 mM NaCl, pH 6.8.

<1 EU/μg; determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.