TAFA2/FAM19A2 Protein, Human
Based on 1 Customer Validation
The FAM19A2 protein plays a key role as a neurotrophic factor, actively promoting neuronal survival and various neurobiological functions. Its involvement is shown to have a critical impact on the maintenance and health of neurons, underscoring its potential significance in supporting neurological health. TAFA2/FAM19A2 Protein, Human is the recombinant human-derived TAFA2/FAM19A2 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The FAM19A2 protein plays a key role as a neurotrophic factor, actively promoting neuronal survival and various neurobiological functions. Its involvement is shown to have a critical impact on the maintenance and health of neurons, underscoring its potential significance in supporting neurological health. TAFA2/FAM19A2 Protein, Human is the recombinant human-derived TAFA2/FAM19A2 protein, expressed by E. coli , with tag free.
The FAM19A2 protein functions as a neurotrophic factor, playing a critical role in promoting neuronal survival and contributing to various neurobiological functions. Its involvement in supporting the well-being and persistence of neurons underscores its significance in maintaining proper neuronal health. The characterization of FAM19A2 as a neurotrophic factor suggests its potential relevance in neuroprotective strategies and the modulation of essential processes within the nervous system.
1. The biological activity is determined by its ability to enhance neurite outgrowth of E16-E18 rat embryonic cortical neurons. rHuTAFA-2; immobilized at 6-24 μg/mL on a 96 well plate; is able to significantly enhance neurite outgrowth.
2. Measured in a cell proliferation assay using SH-SY5Y human neuroblastoma cells. The ED50 this effect is 1.455-3.659 μg/mL, corresponding to a specific activity is > 273.30 units/mg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q8N3H0-1 (A31-H131)
-
Molecular Construction
-
N-term
-
TAFA2 (A31-H131)
Accession # Q8N3H0-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Synonyms
TAFA2; Family With Sequence Similarity 19 Member A2, C-C Motif Chemokine Like; Prev. FAM19A2; Family With Sequence Similarity 19 (Chemokine (C-C Motif)-Like), Member A2; TAFA-2; Protein FAM19A2; TAFA Chemokine Like Family Member 2; Chemokine-Like Protein
-
AA Sequence
ANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH
-
Predicted Molecular Mass
11.2 kDa
-
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of 2×PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 40 mM PB, 300 mM NaCl, pH 6.8.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg; determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
