1. Recombinant Proteins
  2. Others
  3. Tenascin/Tnc protein, Mouse (His-Myc, Solution)

Tenascin/Tnc protein, Mouse (His-Myc, Solution)

Cat. No.: HY-P700002A
COA Handling Instructions

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc protein, Mouse (His-Myc, Solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag. The total length of Tenascin/Tnc protein, Mouse (His-Myc, Solution) is 216 a.a., with molecular weight of ~27 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $276 In-stock
10 μg $470 In-stock
50 μg $1220 In-stock
100 μg $1950 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc protein, Mouse (His-Myc, Solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag. The total length of Tenascin/Tnc protein, Mouse (His-Myc, Solution) is 216 a.a., with molecular weight of ~27 kDa.

Background

The Tenascin/Tnc protein, an extracellular matrix protein, assumes a critical role in guiding migrating neurons and axons during development, as well as contributing to synaptic plasticity and neuronal regeneration. It not only promotes neurite outgrowth in cultured neurons but also may play a role in supporting the growth of epithelial tumors, underscoring its diverse functional implications. Serving as a ligand for integrins ITGA8:ITGB1, ITGA9:ITGB1, ITGAV:ITGB3, and ITGAV:ITGB6, Tenascin/Tnc establishes molecular interactions essential for cellular communication and signaling. In the context of tumors, it stimulates angiogenesis by facilitating the elongation, migration, and sprouting of endothelial cells. Structurally, Tenascin/Tnc exists as a homohexamer with a potential homotrimer formation in the triple coiled-coil region, further stabilized by disulfide rings at both ends. The interaction with CSPG4 suggests its involvement in intricate cellular and molecular processes across diverse biological contexts.

Biological Activity

Measured by the ability of the immobilized protein to block Fibronectin-mediated adhesion of NIH-3T3 mouse embryonic fibroblast cells. Tenascin immobilized at 0.8 μg/mL, in the presence of 0.1 μg/mL human Fibronectin, will block approximately 54.01% NIH-3T3 cell adhesion (5×104 cells/well, 100 μL/well).

Species

Mouse

Source

HEK293

Tag

N-10*His;C-Myc

Accession

Q80YX1 (G1884-N2099)

Gene ID

21923  [NCBI]

Molecular Construction
N-term
10*His
Tenascin (G1884-N2099)
Accession # Q80YX1
Myc
C-term
Synonyms
Tenascin; TN; Hexabrachion; Tenascin-C (TN-C)
AA Sequence

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Molecular Weight

Approximately 27 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4, 20% Glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Tenascin/Tnc protein, Mouse (His-Myc, Solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Tenascin/Tnc protein, Mouse (His-Myc, Solution)
Cat. No.:
HY-P700002A
Quantity:
MCE Japan Authorized Agent: