Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

Background

The Tenascin/Tnc protein, an extracellular matrix protein, assumes a critical role in guiding migrating neurons and axons during development, as well as contributing to synaptic plasticity and neuronal regeneration. It not only promotes neurite outgrowth in cultured neurons but also may play a role in supporting the growth of epithelial tumors, underscoring its diverse functional implications. Serving as a ligand for integrins ITGA8:ITGB1, ITGA9:ITGB1, ITGAV:ITGB3, and ITGAV:ITGB6, Tenascin/Tnc establishes molecular interactions essential for cellular communication and signaling. In the context of tumors, it stimulates angiogenesis by facilitating the elongation, migration, and sprouting of endothelial cells. Structurally, Tenascin/Tnc exists as a homohexamer with a potential homotrimer formation in the triple coiled-coil region, further stabilized by disulfide rings at both ends. The interaction with CSPG4 suggests its involvement in intricate cellular and molecular processes across diverse biological contexts.

Verified Bioactivity

Measured by the ability of the immobilized protein to block Fibronectin-mediated adhesion of NIH-3T3 mouse embryonic fibroblast cells. Tenascin immobilized at 0.8 μg/mL, in the presence of 0.1 μg/mL human Fibronectin, will block approximately 54.01% NIH-3T3 cell adhesion (5×104 cells/well, 100 μL/well).

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag N-10*His;C-Myc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • Tenascin (G1884-N2099)
      Accession # Q80YX1-1
    • Myc
    • C-term
  • Protein Length

    Full Length of Fibrinogen C-terminal Domain

  • Synonyms

    TNC; Neuronectin; Prev. HXB; Cytotactin; Prev. DFNA56; Tenascin-C; TN; MGC167029; Tenascin; GMEM; Glioma-Associated-Extracellular Matrix Antigen; TN-C; Deafness, Autosomal Dominant 56; JI; Tenascin-C Additional Domain 1; Hexabrachion (Tenascin C, Cytotact

  • AA Sequence

    GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

  • Predicted Molecular Mass

    25.9 kDa

  • Molecular Weight

    Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00