Tetranectin/CLEC3B Protein, Mouse (HEK293, His)

Tetranectin/CLEC3B protein exhibits binding to plasminogen and isolated kringle 4, suggesting potential roles in exocytosis-related molecule packaging and ocular physiology. Its homotrimeric structure emphasizes a propensity for trimeric complexes, highlighting the multifaceted nature of Tetranectin/CLEC3B in diverse molecular interactions and cellular processes. Tetranectin/CLEC3B Protein, Mouse (HEK293, His) is the recombinant mouse-derived Tetranectin/CLEC3B protein, expressed by HEK293 , with C-His labeled tag. The total length of Tetranectin/CLEC3B Protein, Mouse (HEK293, His) is 181 a.a., with molecular weight of ~25 kDa.

The Tetranectin/CLEC3B protein demonstrates binding capabilities to plasminogen and isolated kringle 4. It is implicated in potential roles related to the packaging of molecules designated for exocytosis, suggesting a function in cellular secretion processes. Additionally, Tetranectin/CLEC3B plays a role in retinal function, indicating its involvement in ocular physiology. Structurally, it forms homotrimers, emphasizing its tendency to exist as trimeric complexes. The diverse binding capacities and proposed functions underscore the multifaceted nature of Tetranectin/CLEC3B, implicating its involvement in various molecular interactions and cellular processes.

Mouse

HEK293

C-His

P43025 (E22-V202)

21922  [NCBI]

ESPTPKAKKAANAKKDLVSSKMFEELKNRMDVLAQEVALLKEKQALQTVCLKGTKVNLKCLLAFTQPKTFHEASEDCISQGGTLGTPQSELENEALFEYARHSVGNDANIWLGLNDMAAEGAWVDMTGGLLAYKNWETEITTQPDGGKAENCAALSGAANGKWFDKRCRDQLPYICQFAIVAHHHHHH

Approximately 25 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.