1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TFF2 Protein, Human (His)

TFF2 Protein, a pivotal regulator in the gastrointestinal tract, inhibits gastrointestinal motility and gastric acid secretion. Its potential role as a structural component in gastric mucus is indicated, suggesting contributions to glycoprotein stabilization through interactions with carbohydrate side chains. This multifunctional role underscores TFF2's importance in preserving the integrity and homeostasis of the gastric environment. TFF2 Protein, Human (His) is the recombinant human-derived TFF2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TFF2 Protein, a pivotal regulator in the gastrointestinal tract, inhibits gastrointestinal motility and gastric acid secretion. Its potential role as a structural component in gastric mucus is indicated, suggesting contributions to glycoprotein stabilization through interactions with carbohydrate side chains. This multifunctional role underscores TFF2's importance in preserving the integrity and homeostasis of the gastric environment. TFF2 Protein, Human (His) is the recombinant human-derived TFF2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

TFF2 protein plays a regulatory role in the gastrointestinal tract by inhibiting both gastrointestinal motility and gastric acid secretion. Its potential involvement as a structural component in gastric mucus is suggested, wherein it might contribute to the stabilization of glycoproteins within the mucus gel through interactions with carbohydrate side chains. This multifaceted function positions TFF2 as a crucial player in maintaining the integrity and homeostasis of the gastric environment.

Biological Activity

Measured by its ability to chemoattract bioassay using human MCF-7 cells. The ED50 for this effect is 20.9 ng/mL, corresponding to a specific activity is 4.7846×104 units/mg.

  • Measured by its ability to chemoattract bioassay using human MCF-7 cells. The ED50 for this effect is 20.9 ng/mL, corresponding to a specific activity is 4.7846×104 units/mg.
Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q03403 (E24-Y129)

Gene ID
Molecular Construction
N-term
6*His
TFF2 (E24-Y129)
Accession # Q03403
C-term
Protein Length

Full Length of Mature Protein

Synonyms
SML 1; SML1; SP; Spasmolysin; Spasmolytic polypeptide; spasmolytic protein 1 ; TFF 2; TFF2; TFF2_HUMAN; trefoil factor 2 spasmolytic protein 1; ; Trefoil factor 2; Trefoil factor 2 precursor
AA Sequence

EKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY

Molecular Weight

Approximately 14 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TFF2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TFF2 Protein, Human (His)
Cat. No.:
HY-P71929A
Quantity:
MCE Japan Authorized Agent: