Copy Link Print Information

TFPI Protein, Human (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

TFPI protein, encoded by the TFPI gene, is an important Kunitz-type serine protease inhibitor that regulates TF-dependent pathways in coagulation. It inhibits factor X and VIIa-TF proteases, preventing excessive clot formation. TFPI Protein, Human (HEK293, His) is the recombinant human-derived TFPI protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • TFPI Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TFPI protein, encoded by the TFPI gene, is an important Kunitz-type serine protease inhibitor that regulates TF-dependent pathways in coagulation. It inhibits factor X and VIIa-TF proteases, preventing excessive clot formation. TFPI Protein, Human (HEK293, His) is the recombinant human-derived TFPI protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The TFPI gene encodes a Kunitz-type serine protease inhibitor crucial for regulating the tissue factor (TF)-dependent pathway in blood coagulation. This pathway is initiated by the formation of a factor VIIa-TF complex, activating additional proteases (factors IX and X) and culminating in fibrin clot formation. The TFPI protein acts as an autoregulatory loop inhibitor, targeting both activated factor X and VIIa-TF proteases. In animal models of hemophilia, inhibition of this protein has shown promise in restoring hemostasis. The gene produces multiple protein isoforms, each differing in inhibitory activity, specificity, and cellular localization. Notably, TFPI exhibits broad expression across various tissues, including liver, placenta, and others.

Verified Bioactivity

Measured by its ability to inhibit trypsin cleavage of a fluorogenic peptide substrate, Mca-RPKPVE-Nval-WRK(Dnp)-NH2 (HY-P2185A). The IC50 value is 0.67 nM.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P10646/NP_006278.1(D29-K282)

  • Gene ID
    7035  [NCBI]
  • Molecular Construction
    • N-term
    • TFPI (D29-K282)
      Accession # NP_006278.1
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    TFPI; EPI; Prev. LACI; Tissue Factor Pathway Inhibitor (Lipoprotein-Associated Coagulation Inhibitor); Extrinsic Pathway Inhibitor; Lipoprotein-Associated Coagulation Inhibitor; TFPI1; Anti-Convertin; Tissue Factor Pathway Inhibitor; TFI

  • AA Sequence

    DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIK

  • Predicted Molecular Mass

    30 kDa

  • Molecular Weight

    Approximately 37-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • TFPI Protein, Human (HEK293, His) Product Image
    1/16
  • TFPI Protein, Human (HEK293, His) Product Image