TFPI Protein, Human (HEK293, His)

TFPI protein, encoded by the TFPI gene, is an important Kunitz-type serine protease inhibitor that regulates TF-dependent pathways in coagulation. It inhibits factor X and VIIa-TF proteases, preventing excessive clot formation. TFPI Protein, Human (HEK293, His) is the recombinant human-derived TFPI protein, expressed by HEK293 , with C-His, C-6*His labeled tag. The total length of TFPI Protein, Human (HEK293, His) is 254 a.a., with molecular weight of 42-45 kDa.

The TFPI gene encodes a Kunitz-type serine protease inhibitor crucial for regulating the tissue factor (TF)-dependent pathway in blood coagulation. This pathway is initiated by the formation of a factor VIIa-TF complex, activating additional proteases (factors IX and X) and culminating in fibrin clot formation. The TFPI protein acts as an autoregulatory loop inhibitor, targeting both activated factor X and VIIa-TF proteases. In animal models of hemophilia, inhibition of this protein has shown promise in restoring hemostasis. The gene produces multiple protein isoforms, each differing in inhibitory activity, specificity, and cellular localization. Notably, TFPI exhibits broad expression across various tissues, including liver, placenta, and others.

Human

HEK293

C-His;C-6*His

P10646/NP_006278.1(D29-K282)

7035  [NCBI]

DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIK

42-45 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.