1. Recombinant Proteins
  2. Others
  3. TFPI2 Protein, Mouse (HEK293, hFc)

TFPI2 Protein, Mouse (HEK293, hFc)

Cat. No.: HY-P74528
COA Handling Instructions

TFPI2 (tissue factor pathway inhibitor 2) is a key regulator of matrix remodeling and has inhibitory control effects on trypsin, plasmin and factor VIIa/tissue factor. It has a weak effect on factor Xa and has no effect on thrombin. Its complex interactions extend to the formation of molecular complexes with ABCB1 and PPP2R3C, resulting in dephosphorylation of ABCB1. TFPI2 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TFPI2 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of TFPI2 Protein, Mouse (HEK293, hFc) is 208 a.a., with molecular weight of 55-70 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $65 In-stock
10 μg $110 In-stock
50 μg $305 In-stock
100 μg $520 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TFPI2 (tissue factor pathway inhibitor 2) is a key regulator of matrix remodeling and has inhibitory control effects on trypsin, plasmin and factor VIIa/tissue factor. It has a weak effect on factor Xa and has no effect on thrombin. Its complex interactions extend to the formation of molecular complexes with ABCB1 and PPP2R3C, resulting in dephosphorylation of ABCB1. TFPI2 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TFPI2 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of TFPI2 Protein, Mouse (HEK293, hFc) is 208 a.a., with molecular weight of 55-70 kDa.

Background

TFPI2 (Tissue Factor Pathway Inhibitor 2) emerges as a key regulator in the intricate web of matrix remodeling orchestrated by plasmin. Its inhibitory prowess extends to trypsin, plasmin, and factor VIIa/tissue factor, with a weaker effect on factor Xa, while remaining inert to thrombin. Beyond its direct inhibitory actions, TFPI2 engages in complex interactions, forming a molecular alliance with ABCB1 and PPP2R3C. This complex formation results in the dephosphorylation of ABCB1, highlighting TFPI2's involvement in dynamic cellular processes that go beyond its primary inhibitory functions.

Biological Activity

Measured by its ability to inhibit trypsin cleavage of a fluorogenic peptide substrate, Mca-RPKPVE-Nval-WRK(Dnp)-NH2. The IC50 value is 2.585 nM, as measured under the described conditions.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

O35536 (L23-S230)

Gene ID

21789  [NCBI]

Molecular Construction
N-term
TFPI2 (L23-S230)
Accession # O35536
hFc
C-term
Synonyms
Tissue factor pathway inhibitor 2; TFPI-2;
AA Sequence

LTSVSAQGNNLEICLLPLDAGPCQALIPKFYYDRDQQKCRRFNYGGCLGNANNFHSRDLCQQTCGSIEKVPPVCRSELKTYPCDKPNIRFFFNLNTMTCEPLRPGLCSRTINVFSEEATCKGLCEPRKHIPSFCSSPKDEGLCSANVTRFYFNSRNKTCETFTYTGCGGNENNFYYLDACHRACVKGWKKPKRWKIGDFLPRFWKHLS

Molecular Weight

55-70 kDa

Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TFPI2 Protein, Mouse (HEK293, hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TFPI2 Protein, Mouse (HEK293, hFc)
Cat. No.:
HY-P74528
Quantity:
MCE Japan Authorized Agent: