1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily Neurotrophic Factors
  4. TGF-β
  5. TGF-β1
  6. TGF beta 1/TGFB1 Protein, Human (HEK293)

TGF beta 1/TGFB1 Protein is initially identified as a growth factor that induces the growth of rodent fibroblasts. TGF beta 1/TGFB1 Protein inhibits the cell cycle in the G1 phase. TGF beta 1/TGFB1 is an endogenous factor controlling apoptosis in normal and pathological tissues. TGF beta 1/TGFB1 Protein, Human (HEK293) is a recombinant protein (A279-S390) produced by HEK293 cells.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
2 μg 해외재고보유
10 μg 해외재고보유
20 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products

50 Publications Citing Use of MCE TGF beta 1/TGFB1 Protein, Human (HEK293)

WB
RT-PCR

    TGF beta 1/TGFB1 Protein, Human (HEK293) purchased from MCE. Usage Cited in: Nat Commun. 2025 Feb 21;16(1):1865.  [Abstract]

    Immunoblot analysis was conducted to assess the effect of siRNA-mediated FOXN3 knockdown on the levels of Smad proteins in both A549 and primary ATII cells upon TGF-β treatment (10 ng/mL, 16 hr). The cells were treated with 0.05% fetal bovine serum (FBS) for 8h prior to TGF-β treatment and collected 48 hrs post-siRNA transfection. TCL: total cell lysate.

    TGF beta 1/TGFB1 Protein, Human (HEK293) purchased from MCE. Usage Cited in: Clin Mol Hepatol. 2023 Apr;29(2):465-481.  [Abstract]

    Protein levels of α-SMA and collagen 1 in LX-2 and JS-1 cells after TGF β (10 ng/mL, 24h) treatment.

    TGF beta 1/TGFB1 Protein, Human (HEK293) purchased from MCE. Usage Cited in: Clin Mol Hepatol. 2023 Apr;29(2):465-481.  [Abstract]

    mRNA levels of α-SMA and collagen 1 in LX-2 and JS-1 cells after TGF β (10 ng/mL, 24h) treatment.

    TGF beta 1/TGFB1 Protein, Human (HEK293) purchased from MCE. Usage Cited in: Cells. 2022 Nov 5;11(21):3505.  [Abstract]

    Western blot analysis of Vimentin, α-SMA in HK-2 cells after TGF β (10 ng/mL, 48 h) treatment.

    TGF beta 1/TGFB1 Protein, Human (HEK293) purchased from MCE. Usage Cited in: Cells. 2022 Nov 5;11(21):3505.  [Abstract]

    Protein expression levels of Collagen I and Fibronectin in HK-2 cells after TGF β (10 ng/mL, 48 h) treatment were detected by Western blot.
    • Biological Activity

    • Technical Parameters

    • Properties

    • 제품 설명

    • References

    제품 설명

    TGF beta 1/TGFB1 Protein is initially identified as a growth factor that induces the growth of rodent fibroblasts. TGF beta 1/TGFB1 Protein inhibits the cell cycle in the G1 phase. TGF beta 1/TGFB1 is an endogenous factor controlling apoptosis in normal and pathological tissues. TGF beta 1/TGFB1 Protein, Human (HEK293) is a recombinant protein (A279-S390) produced by HEK293 cells[1][2].

    Background

    TGFβ is released from degranulating platelets and secreted by all of the major cell types participating in the repair process, including lymphocytes, macrophages, endothelial cells, smooth muscle cells, epithelial cells, and fibroblasts. Mammals express three isoforms of TGFβdesignated TGFβI, TGFβ2, and TGFβ3; TGFβ1 is the most abundant isoform in all tissues, and in human platelets it is the only isoform of the peptide. Certain cells such as retinal pigment epithelial cells secrete predominantly TGFβ2, and certain body fluids such as the aqueous and vitreous of the eye, amniotic fluid, saliva, and breast milk contain principally TGFβ2. TGFβ3 is the least studied of the TGFβ isoforms. It has been isolated from human umbilical cord and is secreted from certain cells, including myoblast celllines; however, it is usually less abundant than either TGFβ1 or TGFβ2 in both tissue and cell extracts[1]. There are three fundamental directions of its activities: I. TGFβ1 regulates cell proliferation, growth, differentiation and cells movement. II. TGFβ1 has immunomodulatory effects. III. TGFβ1 has profibrogenic effects. TGFβ1 action can be local and systemic[2].

    In Vitro

    TGF beta 1/TGFB1 Protein, Human (1 ng/mL) inhibits cell proliferation, migration and capillary-like structure formation, disrupts VE-cadherin localization and increases monolayer permeability in bovine corpus luteum microvascular endothelial cells (CLENDO)[4].
    TGF beta 1/TGFB1 Protein, Human (0.2 ng/mL; 12 h) induces SMAD4 protein stabilization, activates TGF-β/SMAD2/3 signaling pathway by competitively inhibiting β-TrCP-mediated ubiquitination degradation and promotes EMT in human colorectal cancer cells (LoVo, HCT-116)[5].
    TGF beta 1/TGFB1 Protein, Human (0.2 ng/mL; 4 weeks) significantly increases calcium deposition and mRNA expression of bone-specific proteins (alkaline phosphatase, type I collagen, osteocalcin) in SaOs-2 and primary human osteoblasts (HOB)[6].
    TGF beta 1/TGFB1 Protein, Human (5 ng/mL; 3-16 h) induces increased IL-6 secretion in human trabecular meshwork cells (HTM) via p38 MAPK and JNK pathways[7].

    Biological Activity

    1.Immobilized Human Mature TGF beta 1, No Tag at 0.5 μg/mL (100 μl/well) on the plate. Dose response curve for Human TGF-beta RII, mFc Tag with the EC50 of <8 ng/mL determined by ELISA.
    2.Measured by its ability to inhibit cell proliferation of Mv-1-lu mink lung epithelial cells. The ED50 for this effect is <0.1 ng/mL, corresponding to a specific activity is >1×107 units/mg.

    • Measured by its ability to inhibit cell proliferation of Mv-1-lu mink lung epithelial cells. The ED50 for this effect is 0.0964 ng/mL, corresponding to a specific activity is 1.037×107 units/mg.
    Species

    Human

    Source

    HEK293

    Tag

    Tag Free

    Accession

    P01137 (A279-S390)

    Gene ID
    Molecular Construction
    N-term
    TGFB1 (A279-S390)
    Accession # P01137
    C-term
    Protein Length

    Full Length of Mature TGFB1

    Synonyms
    Transforming Growth Factor Beta-1; TGF-Beta-1; Latency-Associated Peptide; LAP; TGFB1; TGFB; TGF-β1; TGF beta1; TGFbeta 1; TGF-beta 1; TGFbeta; TGF-beta-1
    AA Sequence

    ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

    Predicted Molecular Mass
    13.2 kDa
    분자량

    Approximately 13-15 kDa under reduced (R) conditions, 26-30 kDa under non reducing (N) conditions, based on SDS-PAGE.

    Glycosylation
    Yes
    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.2 μm filtered solution of 50 mM Glycine 150 mM NaCl, pH 2.5.
    2.Lyophilized from a 0.2 μm filtered solution of 4 mM HCL, pH 2.5.
    Please refer to the lot-specific COA for specific buffer information.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in 4mM HCl.

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    선적

    Room temperature in continental US; may vary elsewhere.

    각종 서류
    References
    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    최근 본 상품:

    온라인 문의

    Your information is safe with us. * Required Fields.

    TGF beta 1/TGFB1 Protein, Human (HEK293)

     

    Requested Quantity *

    고객명 *

     

    호칭

    메일주소 *

     

    전화번호 *

    Department

     

    회사명 *

    City

    Country or Region *

         

    비고

    대량구매 문의

    Inquiry Information

    상품명:
    TGF beta 1/TGFB1 Protein, Human (HEK293)
    Cat. No.:
    HY-P70543
    수량:
    MCE Japan Authorized Agent: