1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily
  4. TGF-beta & TβRs
  5. TGF-beta receptor 2 Protein, Human (HEK293, Fc)

TGF-beta receptor 2 Protein, Human (HEK293, Fc)

Cat. No.: HY-P7426
Handling Instructions

TGF-beta receptor 2 Protein, Human (HEK293, Fc), a fragment of transforming growth factor-beta receptor type 2 (TβRII), consists of amino acid of Thr23-Asp159 with an Fc tag at the C-terminus.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $210 In-stock
Estimated Time of Arrival: December 31
50 μg $590 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

TGF-beta receptor 2 Protein, Human (HEK293, Fc) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

HEK293

Tag

C-hFc

Accession

P37173 (T23-D159)

Gene ID

7048

Synonyms
TGFR-2; TGF-beta type II receptor; TGF-beta receptor type 2; TbetaR-II
AA Sequence

TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPD

Molecular Weight

Approximately 59.0 kDa

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Transforming growth factor-beta receptor type 2 (TβRII) is a 567 amino acid single-pass type I membrane protein that contains one protein kinase domain. TβRII is the specific receptor for TGFβ ligands, and crucial for the regulation of TGFβ signaling in tumor initiation, progression, and metastasis[1]. T beta R-II (transforming growth factor beta [TGF-beta] type II receptor) is a transmembrane serine/threonine kinase that acts as the primary TGF-beta receptor. Ligand binding to T beta R-II leads to the recruitment and phosphorylation of T beta R-I, a distantly related transmembrane kinase that acts as a downstream signaling component[2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TGF-beta receptor 2 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P7426
Quantity:
MCE Japan Authorized Agent: