Thymopoietin Protein, Human (His)
Thymopoietin protein critically directs nuclear lamina assembly and maintains structural organization in the nuclear envelope. It is considered a potential receptor that attaches lamina fibrils to the inner nuclear membrane, where it anchors key structural components. Thymopoietin Protein, Human (His) is the recombinant human-derived Thymopoietin protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Thymopoietin protein critically directs nuclear lamina assembly and maintains structural organization in the nuclear envelope. It is considered a potential receptor that attaches lamina fibrils to the inner nuclear membrane, where it anchors key structural components. Thymopoietin Protein, Human (His) is the recombinant human-derived Thymopoietin protein, expressed by E. coli , with C-6*His labeled tag.
Background
Thymopoietin (TP) emerges as a protein that may play a pivotal role in directing the assembly of the nuclear lamina, contributing to the maintenance of structural organization within the nuclear envelope. It is postulated to be a potential receptor for attaching lamin filaments to the inner nuclear membrane, suggesting its involvement in anchoring crucial structural components. Furthermore, TP may participate in the control of DNA replication initiation through interaction with NAKAP95, implicating its regulatory function in cellular processes. Beyond its structural and regulatory roles, both Thymopoietin (TP) and its derivative Thymopentin (TP5) are associated with potential functions in T-cell development and function, with TP5 specifically noted as an immunomodulating pentapeptide, highlighting the multifaceted contributions of Thymopoietin to cellular and immune processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P42167 (M1-E187)
-
Molecular Construction
-
N-term
-
Thymopoietin (M1-E187)
Accession # P42167 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
TMPO; Thymopoietin, Isoforms Beta/Gamma; Thymopoietin; Lamina-Associated Polypeptide 2; LAP2; Thymopoietin Isoform Alpha; LEMD4; TPRP Isoforms Beta/Gamma; TP; TPRP Isoform Alpha; LEM Domain Containing 4; TP Beta/Gamma; Lamina-Associated Polypeptide 2, Iso
-
AA Sequence
MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKGPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNE
-
Predicted Molecular Mass
21.6 kDa
-
Molecular Weight
Approximately 27 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
