1. Recombinant Proteins
  2. Others
  3. Thymopoietin Protein, Human (His)

Thymopoietin protein critically directs nuclear lamina assembly and maintains structural organization in the nuclear envelope. It is considered a potential receptor that attaches lamina fibrils to the inner nuclear membrane, where it anchors key structural components. Thymopoietin Protein, Human (His) is the recombinant human-derived Thymopoietin protein, expressed by E. coli , with C-6*His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

Thymopoietin protein critically directs nuclear lamina assembly and maintains structural organization in the nuclear envelope. It is considered a potential receptor that attaches lamina fibrils to the inner nuclear membrane, where it anchors key structural components. Thymopoietin Protein, Human (His) is the recombinant human-derived Thymopoietin protein, expressed by E. coli , with C-6*His labeled tag.

Background

Thymopoietin (TP) emerges as a protein that may play a pivotal role in directing the assembly of the nuclear lamina, contributing to the maintenance of structural organization within the nuclear envelope. It is postulated to be a potential receptor for attaching lamin filaments to the inner nuclear membrane, suggesting its involvement in anchoring crucial structural components. Furthermore, TP may participate in the control of DNA replication initiation through interaction with NAKAP95, implicating its regulatory function in cellular processes. Beyond its structural and regulatory roles, both Thymopoietin (TP) and its derivative Thymopentin (TP5) are associated with potential functions in T-cell development and function, with TP5 specifically noted as an immunomodulating pentapeptide, highlighting the multifaceted contributions of Thymopoietin to cellular and immune processes.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P42167 (M1-E187)

Gene ID
Molecular Construction
N-term
Thymopoietin (M1-E187)
Accession # P42167
6*His
C-term
Protein Length

Partial

Synonyms
Lamina-Associated Polypeptide 2 Isoforms Beta/Gamma; Thymopoietin Isoforms Beta/Gamma; TP Beta/Gamma; Thymopoietin-Related Peptide Isoforms Beta/Gamma; TPRP Isoforms Beta/Gamma; Thymopoietin; TP; Splenin; Thymopentin; TP5; TMPO; LAP2
AA Sequence

PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKGPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNE

Predicted Molecular Mass
21.6 kDa
분자량

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

Thymopoietin Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Thymopoietin Protein, Human (His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Thymopoietin Protein, Human (His)
Cat. No.:
HY-P71361
수량:
MCE Japan Authorized Agent: