1. Recombinant Proteins
  2. Immune Checkpoint Proteins
  3. Inhibitory checkpoint molecules
  4. TIGIT Protein
  5. TIGIT Protein, Cynomolgus (HEK 293, Fc)

TIGIT Protein, Cynomolgus (HEK 293, Fc)

Cat. No.: HY-P71007
Handling Instructions
Top Publications Citing Use of Products

TIGIT Protein, Cynomolgus (HEK 293, Fc) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Cynomolgus

Source

HEK293

Tag

C-hFc

Accession

G7NXM4 (M89-P209)

Synonyms
T-cell immunoreceptor with Ig and ITIM domains; VSIG9; VSTM3; TIGIT; V-set and transmembrane domain-containing protein 3; V-set and immunoglobulin domain-containing protein 9
AA Sequence

MMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVNWEQHDHSLLAIRNAELGWHIYPAFKDRVAPGPGLGLTLQSLTMNDTGEYFCTYHTYPDGTYRGRIFLEVLESSVAEHSARFQIP

Molecular Weight

45-55 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Human PVR-His can bind Cynomolgus TIGIT-Fc with an affinity constant of 24.6 nM.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TIGIT Protein, Cynomolgus (HEK 293, Fc)
Cat. No.:
HY-P71007
Quantity:
MCE Japan Authorized Agent: