2. Recombinant Proteins
  3. Immune Checkpoint Proteins
  4. Inhibitory Checkpoint Molecules
  5. TIGIT Protein
  6. TIGIT Protein, Cynomolgus (HEK293, Fc)

TIGIT Protein, Cynomolgus (HEK293, Fc)

Cat. No.: HY-P76674
Handling Instructions

TIGIT is a receptor of the Ig superfamily that plays a key role in restricting adaptive and innate immunity. TIGIT can be used as an immune modulator to inhibit the activity of T cells and NK cells, and also regulates the recognition of cancer cells. TIGIT consists of an extracellular immunoglobulin (Ig) variable domain, a type 1 transmembrane domain, and a cytoplasmic tail with two inhibitory motifs. TIGIT Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived TIGIT protein, expressed by HEK293 , with C-hFc labeled tag. The total length of TIGIT Protein, Cynomolgus (HEK293, Fc) is 183 a.a., with molecular weight of ~47.2 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TIGIT is a receptor of the Ig superfamily that plays a key role in restricting adaptive and innate immunity. TIGIT can be used as an immune modulator to inhibit the activity of T cells and NK cells, and also regulates the recognition of cancer cells. TIGIT consists of an extracellular immunoglobulin (Ig) variable domain, a type 1 transmembrane domain, and a cytoplasmic tail with two inhibitory motifs. TIGIT Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived TIGIT protein, expressed by HEK293 , with C-hFc labeled tag. The total length of TIGIT Protein, Cynomolgus (HEK293, Fc) is 183 a.a., with molecular weight of ~47.2 kDa.
Background

TIGIT binds to the poliovirus receptor (PVR) or PVR2, which can inhibit the activity of T and natural killer (NK) cells. In addition, TIGIT also regulates the recognition of cancer cells. Therefore, TIGIT is considered to be a promising target for cancer immunotherapy. TIGIT has three ligands: CD155, CD112, and CD113. The binding of TIGIT to CD155 promotes the direct and indirect downregulation of T cell response. In summary, TIGIT can act as an immune modulator and play a key role in limiting adaptive immunity and innate immunity[1][2][3].
Species

Cynomolgus
Source

HEK293
Tag

C-hFc
Accession

XP_015300911 (K27-P209)
Gene ID

102121588  [NCBI]
Molecular Construction
N-term
TIGIT (K27-P209)
Accession # XP_015300911
hFc
C-term
Synonyms
T cell immunoreceptor with Ig and ITIM domains; TIGIT; VSIG9; VSTM3
AA Sequence

KPGFSETVFSHRLSFTVLSAVGYFRWQKRPHLLPVSPLGRSMRWCLFLIWAQGLRQAPLASGMMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVNWEQHDHSLLAIRNAELGWHIYPAFKDRVAPGPGLGLTLQSLTMNDTGEYFCTYHTYPDGTYRGRIFLEVLESSVAEHSARFQIP

Molecular Weight

Approximately 47.2 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

TIGIT Protein, Cynomolgus (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TIGIT Protein, Cynomolgus (HEK293, Fc)
Cat. No.:
HY-P76674
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.