TIGIT Protein, Rat (137a.a, HEK293, Fc)

T-cell immunoreceptor with Ig and ITIM domains (TIGIT) is a member of the PVR (poliovirus receptor) family of immunoglobin proteins, binds with high affinity to the poliovirus receptor (PVR) which causes increased secretion of IL10 and decreased secretion of IL12B and suppresses T-cell activation or T cell dependent B cell responses by promoting the generation of mature immunoregulatory dendritic cells. TIGIT Protein, Rat (137a.a, HEK293, Fc) is the recombinant rat-derived TIGIT protein, expressed by HEK293 , with C-hFc labeled tag. The total length of TIGIT Protein, Rat (137a.a, HEK293, Fc) is 121 a.a., with molecular weight of ~48-58 kDa.

T-cell immunoreceptor with Ig and ITIM domains (TIGIT) is a member of the PVR (poliovirus receptor) family of immunoglobin proteins, containing an immunoglobulin variable domain, a transmembrane domain and an immunoreceptor tyrosine-based inhibitory motif. TIGIT binds with high affinity to PVR which causes increased secretion of IL10 and decreased secretion of IL12B and suppresses T-cell activation or T cell dependent B cell responses by promoting the generation of mature immunoregulatory dendritic cells. TIGIT is expressed on several classes of T cells including follicular B helper T cells (TFH) ^[1].

Measured by its binding ability in a functional ELISA. Immobilized human Nectin-2 at 5 μg/mL (100 μL/well) can bind Biotinylated Rat TIGIT. The ED₅₀ for this effect is 0.04812 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized human Nectin-2 at 5 μg/mL (100 μL/well) can bind Biotinylated Rat TIGIT. The ED₅₀ for this effect is 0.04812 μg/mL.

Rat

HEK293

C-hFc

XP_008766987 (A17-A137)

363784  [NCBI]

AFLAAGATAGTMETKGNISAEEGGSVVLQCHFSSDTAEVTQVNWEQRDQLLAVYSVDLGWYVPSVFSDRVVPGPSLGLTFQSLTTNDTGEYFCTYHTYPDGIYKGRIFLKVQESSAHFQIA

Approximately 48-58 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.