1. Recombinant Proteins
  2. Receptor Proteins
  3. TIM-1/KIM-1/HAVCR Protein, Rat (HEK293, His-Fc)

TIM-1/KIM-1/HAVCR Protein, Rat (HEK293, His-Fc)

Cat. No.: HY-P73601
Handling Instructions Technical Support

TIM-1/KIM-1/HAVCR protein is a phosphatidylserine receptor that plays a crucial regulatory role in regulatory B cells, affecting their generation, expansion and inhibitory functions. It acts as a ligand for P-selectin/SELPLG and controls activated T cell trafficking during inflammatory responses. TIM-1/KIM-1/HAVCR Protein, Rat (HEK293, His-Fc) is the recombinant rat-derived TIM-1/KIM-1/HAVCR protein, expressed by HEK293 , with N-hFc, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TIM-1/KIM-1/HAVCR protein is a phosphatidylserine receptor that plays a crucial regulatory role in regulatory B cells, affecting their generation, expansion and inhibitory functions. It acts as a ligand for P-selectin/SELPLG and controls activated T cell trafficking during inflammatory responses. TIM-1/KIM-1/HAVCR Protein, Rat (HEK293, His-Fc) is the recombinant rat-derived TIM-1/KIM-1/HAVCR protein, expressed by HEK293 , with N-hFc, C-His labeled tag.

Background

TIM-1/KIM-1/HAVCR Protein serves as a phosphatidylserine receptor with a crucial functional role in the homeostasis of regulatory B-cells, influencing their generation, expansion, and suppressor functions. Additionally, as a ligand for P-selectin/SELPLG, it assumes a specialized role in the trafficking of activated T-cells during inflammatory responses, particularly controlling T-cell accumulation in the inflamed central nervous system and influencing the induction of autoimmune disease. TIM-1/KIM-1/HAVCR also regulates the expression of various anti-inflammatory cytokines and co-inhibitory ligands, including IL10, acting as a modulator of T-cell proliferation. Furthermore, it may play a role in kidney injury and repair. Interactions with STAM and SELPLG contribute to the multifaceted regulatory functions of TIM-1/KIM-1/HAVCR Protein.

Species

Rat

Source

HEK293

Tag

N-hFc;C-His

Accession

O54947/NP_775172.1 (S18-V238)

Gene ID
Molecular Construction
N-term
hFc
TIM-1 (S18-V238)
Accession # O54947/NP_775172.1
His
C-term
Protein Length

Partial

Synonyms
Hepatitis A virus cellular receptor 1; HAVcr-1; KIM-1; TIM-1; CD365; HAVCR1
AA Sequence

SVDSYEVVKGVVGHPVTIPCTYSTRGGITTTCWGRGQCPYSSCQNILIWTNGYQVTYRSSGRYNIKGRISEGDVSLTIENSVDSDSGLYCCRVEIPGWFNDQKMTFSLEVKPEIPTSPPTRPTTTRPTTTRPTTISTRSTHVPTSTRVSTSTPTPEQTQTHKPEITTFYAHETTAEVTETPSYTPADWNGTVTSSEEAWNNHTVRIPLRKPQRNPTKGFYV

Predicted Molecular Mass
52.6 kDa
Molecular Weight

Approximately 90-100 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TIM-1/KIM-1/HAVCR Protein, Rat (HEK293, His-Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TIM-1/KIM-1/HAVCR Protein, Rat (HEK293, His-Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TIM-1/KIM-1/HAVCR Protein, Rat (HEK293, His-Fc)
Cat. No.:
HY-P73601
Quantity:
MCE Japan Authorized Agent: