TIM-3/HAVCR2 Protein, Cynomolgus (HEK293, Fc)

TREM-2 Protein binds to DAP10 activates the PI3K signaling pathway. TREM2 signaling leads to downregulated transcription of genes that promote inflammation (Tnf, Il1b, and Nos2), as well as release of cytokines that prevent activation of anti-tumor CD8+ T cells. In addition, it signaling can antagonize TLR expression and signaling, resulting in reduced production of inflammatory cytokines by cultured mouse macrophages. The neuroprotective effects of TREM2 involve not only production of anti-inflammatory cytokines, but also clearance of abnormal proteins and phagocytosis of apoptotic neurons. TIM-3/HAVCR2 Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived TIM-3/HAVCR2 protein, expressed by HEK293 , with C-hFc labeled tag.

Triggering receptor expressed on myeloid cells 2 (TREM2) is expressed on macrophages, immature monocyte-derived dendritic cells, osteoclasts, and microglia, which are immune cells in the central nervous system. Association of TREM2 with DAP10 activates the PI3K signaling pathway, leading to expression of transcription factors that include AP1, NF-κB, and NFAT. TREM2 signaling leads to downregulated transcription of genes that promote inflammation (Tnf, Il1b, and Nos2), as well as release of cytokines that prevent activation of anti-tumor CD8+ T cells. In addition, it signaling can antagonize TLR expression and signaling, resulting in reduced production of inflammatory cytokines by cultured mouse macrophages. Conversely, TREM2 expression is reduced following inflammatory signaling induction by lipopolysaccharide (a TLR4 ligand) or interferon gamma (IFNG). The neuroprotective effects of TREM2 involve not only production of anti-inflammatory cytokines, but also clearance of abnormal proteins and phagocytosis of apoptotic neurons. And TREM2 is overexpressed in many tumor types and has anti-inflammatory activities^[1][2].

Cynomolgus

HEK293

C-hFc

G7P6Q7/EHH54703.1 (S22-R201)

101926442

Partial

SEVEYIAEVGQNAYLPCSYTPAPPGNLVPVCWGKGACPVFDCSNVVLRTDNRDVNDRTSGRYWLKGDFHKGDVSLTIENVTLADSGVYCCRIQIPGIMNDEKHNVKLVVIKPAKVTPAPTLQRDLTSAFPRMLTTGEHGPAETQTPGSLPDVNLTVSNFFCELQIFTLTNELRDSGATIR

Approximately 60.5 kDa & 35.8 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.