1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Tissue Factor Protein, Human (HEK293, His)

Tissue Factor Protein, Human (HEK293, His)

Cat. No.: HY-P7787
COA Handling Instructions

Tissue Factor Protein, Human (HEK293, His) is a recombinant human CD142 expressed in HEK 293 cells with a His tag at the N-terminus. Coagulation Factor III/CD142 Protein is a principal regulator of oncogenic neoangiogenesis and controls therefore the cancerous process.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $150 In-stock
50 μg $420 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Tissue Factor Protein, Human (HEK293, His) is a recombinant human CD142 expressed in HEK 293 cells with a His tag at the N-terminus. Coagulation Factor III/CD142 Protein is a principal regulator of oncogenic neoangiogenesis and controls therefore the cancerous process[1][2].

Background

Tissue factor (TF), also known as CD142, a 47-kDa transmembrane glycoprotein, is a principal regulator of oncogenic neoangiogenesis and controls therefore the cancerous process. TF is the only membrane-bound coagulation factor (factor III), cofactor, and surface receptor for coagulation factor VII (fVII)/activated fVII (fVIIa). TF is commonly yet selectively expressed by multiple tumor compartments, including but not limited to, the cancer cells, cancer stem cells and tumor vascular endothelial cells, whereas it is negatively, minimally or restrictedly expressed in normal cells. TF regulates tumour growth, embryonic and oncogenic blood vessel formation, inflammation and sepsis[1][2].

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P13726 (G34-E251)

Gene ID
Molecular Construction
N-term
Tissue Factor (G34-E251)
Accession # P13726
6*His
C-term
Synonyms
rHuCD142, His; Tissue Factor; TF; Coagulation Factor III; Thromboplastin; CD142; F3
AA Sequence

GTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFREHHHHHH

Molecular Weight

35-55 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM Tris, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Tissue Factor Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Tissue Factor Protein, Human (HEK293, His)
Cat. No.:
HY-P7787
Quantity:
MCE Japan Authorized Agent: