Coagulation factor III/F3 Protein, Human (HEK293, His)
Based on 1 Customer Validation
Coagulation factor III/F3 Protein, Human (HEK293, His) is a recombinant human CD142 expressed in HEK 293 cells with a His tag at the C-terminus. Coagulation Factor III/CD142 Protein is a principal regulator of oncogenic neoangiogenesis and controls therefore the cancerous process.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Coagulation factor III/F3 Protein, Human (HEK293, His) is a recombinant human CD142 expressed in HEK 293 cells with a His tag at the C-terminus. Coagulation Factor III/CD142 Protein is a principal regulator of oncogenic neoangiogenesis and controls therefore the cancerous process[1][2].
Tissue factor (TF), also known as CD142, a 47-kDa transmembrane glycoprotein, is a principal regulator of oncogenic neoangiogenesis and controls therefore the cancerous process. TF is the only membrane-bound coagulation factor (factor III), cofactor, and surface receptor for coagulation factor VII (fVII)/activated fVII (fVIIa). TF is commonly yet selectively expressed by multiple tumor compartments, including but not limited to, the cancer cells, cancer stem cells and tumor vascular endothelial cells, whereas it is negatively, minimally or restrictedly expressed in normal cells. TF regulates tumour growth, embryonic and oncogenic blood vessel formation, inflammation and sepsis[1][2].
1. Measured by its ability to activate Coagulation Factor VII in cleaving a fluorogenic peptide substrate Boc-VPR-AMC. The AC50 is 0.9399 µg/mL, as measured under the described conditions.
2. Immobilized Recombinant Human TF (C-6His) at 1 μg/mL (100 μL/well) can bind Anti-Human TF Antibody. The ED50 of Anti-Human TF Antibody is 2-3 ng/mL.
3. Loaded Anti-TF-mAb on Pro-A Biosensor, can bind Recombinant Human TF (C-6His) with an affinity constant of 5-25 nM as determined in BLI assay.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P13726-1 (G34-E251)
-
Molecular Construction
-
N-term
-
Tissue Factor (G34-E251)
Accession # P13726-1 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
F3; Coagulation Factor III (Thromboplastin, Tissue Factor); Coagulation Factor III, Tissue Factor; Coagulation Factor III; TF; Thromboplastin; Tissue Factor; CD142 Antigen; CD142; TFA
-
AA Sequence
GTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE
-
Predicted Molecular Mass
25.8 kDa
-
Molecular Weight
Approximately 35-55 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Versteeg HH, et, al. Tissue factor signal transduction in angiogenesis. Carcinogenesis. 2003 Jun;24(6):1009-13. [Content Brief]
[2]. Gomez S, et, al. Current Targets and Bioconjugation Strategies in Photodynamic Diagnosis and Therapy of Cancer. Molecules. 2020 Oct 27;25(21):4964. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
