1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Tissue Factor Protein, Human (HEK293, His)

Tissue Factor Protein, Human (HEK293, His)

Cat. No.: HY-P7787
Handling Instructions

Tissue Factor Protein, Human (HEK293, His) is a recombinant human CD142 expressed in HEK 293 cells with a His tag at the N-terminus. Coagulation Factor III/CD142 Protein is a principal regulator of oncogenic neoangiogenesis and controls therefore the cancerous process[1][2].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $165 In-stock
Estimated Time of Arrival: December 31
50 μg $496 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Tissue Factor Protein, Human (HEK293, His) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

HEK 293

Accession

P13726 (G34-E251)

Gene ID

2152

Synonyms
rHuCD142, His; Tissue Factor; TF; Coagulation Factor III; Thromboplastin; CD142; F3
AA Sequence

GTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFREHHHHHH

Molecular Weight

35-55 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM Tris, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Tissue factor (TF), also known as CD142, a 47-kDa transmembrane glycoprotein, is a principal regulator of oncogenic neoangiogenesis and controls therefore the cancerous process. TF is the only membrane-bound coagulation factor (factor III), cofactor, and surface receptor for coagulation factor VII (fVII)/activated fVII (fVIIa). TF is commonly yet selectively expressed by multiple tumor compartments, including but not limited to, the cancer cells, cancer stem cells and tumor vascular endothelial cells, whereas it is negatively, minimally or restrictedly expressed in normal cells. TF regulates tumour growth, embryonic and oncogenic blood vessel formation, inflammation and sepsis[1][2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Tissue Factor Protein, Human (HEK293, His)
Cat. No.:
HY-P7787
Quantity:
MCE Japan Authorized Agent: