Coagulation factor III/F3 Protein, Human (HEK293, His)

Coagulation factor III/F3 Protein, Human (HEK293, His) is a recombinant human CD142 expressed in HEK 293 cells with a His tag at the C-terminus. Coagulation Factor III/CD142 Protein is a principal regulator of oncogenic neoangiogenesis and controls therefore the cancerous process^[1][2].

Tissue factor (TF), also known as CD142, a 47-kDa transmembrane glycoprotein, is a principal regulator of oncogenic neoangiogenesis and controls therefore the cancerous process. TF is the only membrane-bound coagulation factor (factor III), cofactor, and surface receptor for coagulation factor VII (fVII)/activated fVII (fVIIa). TF is commonly yet selectively expressed by multiple tumor compartments, including but not limited to, the cancer cells, cancer stem cells and tumor vascular endothelial cells, whereas it is negatively, minimally or restrictedly expressed in normal cells. TF regulates tumour growth, embryonic and oncogenic blood vessel formation, inflammation and sepsis^[1][2].

1. Measured by its ability to activate Coagulation Factor VII in cleaving a fluorogenic peptide substrate Boc-VPR-AMC. The AC₅₀ is 0.9399 µg/mL, as measured under the described conditions.
2. Immobilized Recombinant Human TF (C-6His) at 1 μg/mL (100 μL/well) can bind Anti-Human TF Antibody. The ED₅₀ of Anti-Human TF Antibody is 2-3 ng/mL.

Human

HEK293

C-6*His

P13726-1 (G34-E251)

2152  [NCBI]

Extracellular Domain

GTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE

Approximately 35-55 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Versteeg HH, et, al. Tissue factor signal transduction in angiogenesis. Carcinogenesis. 2003 Jun;24(6):1009-13.  [Content Brief]

  [2]. Gomez S, et, al. Current Targets and Bioconjugation Strategies in Photodynamic Diagnosis and Therapy of Cancer. Molecules. 2020 Oct 27;25(21):4964.  [Content Brief]