Tissue Factor Protein, Rat (HEK293, His)

Tissue Factor Protein plays a critical role in blood coagulation. It binds to coagulation factors, activating clotting cascades. Tissue Factor Protein interacts with cells, promoting thrombosis and inflammation. Understanding its functions can aid in developing treatments for blood disorders and cardiovascular diseases. Tissue Factor Protein, Rat (HEK293, His) is the recombinant rat-derived Tissue Factor protein, expressed by HEK293 , with C-His labeled tag. The total length of Tissue Factor Protein, Rat (HEK293, His) is 252 a.a., with molecular weight of 47-52 kDa.

Tissue Factor (TF) functions as a key initiator of blood coagulation, forming a complex with circulating factor VII or VIIa. This [TF:VIIa] complex is pivotal in activating factors IX or X through specific limited proteolysis. In normal hemostasis, TF plays a crucial role by initiating the cell-surface assembly and propagation of the coagulation protease cascade. Additionally, TF interacts with HSPE; however, this interaction is inhibited by heparin. Notably, this interaction promotes the generation of activated factor X and activates coagulation in the presence of activated factor VII, emphasizing the multifaceted role of TF in the intricate processes of blood clotting.

Rat

HEK293

C-His

Q66HI4 (M1-E252)

25584  [NCBI]

MAIPMRPRLLAALAPTFLGFLLLQVAAGAGTPPGKAFNLTWISTDFKTILEWQPKPTNYTYTVQISDRSRNWKYKCTGTTDTECDLTDEIVKDVNWTYEARVLSVPWRNSTHGKETLFGTHGEEPPFTNARKFLPYRDTKIGQPVIQKYEQDGTKLKVTVKDSFTLVRKNGTFLTLRQVFGNDLGYILTYRKDSSTGRKTNTTHTNEFLIDVEKGVSYCFFVQAVIFSRKTNHKSPESITKCTEQWKSVLGE

47-52 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.