Tissue Factor Protein, Rat (HEK293, His)
Based on 1 Customer Validation
Tissue Factor Protein plays a critical role in blood coagulation.It binds to coagulation factors, activating clotting cascades.Tissue Factor Protein interacts with cells, promoting thrombosis and inflammation.Understanding its functions can aid in developing treatments for blood disorders and cardiovascular diseases.Tissue Factor Protein, Rat (HEK293, His) is the recombinant rat-derived Tissue Factor protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Tissue Factor Protein plays a critical role in blood coagulation.It binds to coagulation factors, activating clotting cascades.Tissue Factor Protein interacts with cells, promoting thrombosis and inflammation.Understanding its functions can aid in developing treatments for blood disorders and cardiovascular diseases.Tissue Factor Protein, Rat (HEK293, His) is the recombinant rat-derived Tissue Factor protein, expressed by HEK293 , with C-His labeled tag.
Background
Tissue Factor (TF) functions as a key initiator of blood coagulation, forming a complex with circulating factor VII or VIIa. This [TF:VIIa] complex is pivotal in activating factors IX or X through specific limited proteolysis. In normal hemostasis, TF plays a crucial role by initiating the cell-surface assembly and propagation of the coagulation protease cascade. Additionally, TF interacts with HSPE; however, this interaction is inhibited by heparin. Notably, this interaction promotes the generation of activated factor X and activates coagulation in the presence of activated factor VII, emphasizing the multifaceted role of TF in the intricate processes of blood clotting.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-His
-
Accession
Q66HI4 (A29-E252)
-
Molecular Construction
-
N-term
-
Tissue Factor (A29-E252)
Accession # Q66HI4 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
F3; Coagulation Factor III (Thromboplastin, Tissue Factor); Coagulation Factor III, Tissue Factor; Coagulation Factor III; TF; Thromboplastin; Tissue Factor; CD142 Antigen; CD142; TFA
-
AA Sequence
AGTPPGKAFNLTWISTDFKTILEWQPKPTNYTYTVQISDRSRNWKYKCTGTTDTECDLTDEIVKDVNWTYEARVLSVPWRNSTHGKETLFGTHGEEPPFTNARKFLPYRDTKIGQPVIQKYEQDGTKLKVTVKDSFTLVRKNGTFLTLRQVFGNDLGYILTYRKDSSTGRKTNTTHTNEFLIDVEKGVSYCFFVQAVIFSRKTNHKSPESITKCTEQWKSVLGE
-
Predicted Molecular Mass
27.2 kDa
-
Molecular Weight
Approximately 47-52 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (260 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)