TMED4 Protein, Human (HEK293, Fc)

The TMED4 protein is complexly involved in vesicular protein trafficking in the early secretory pathway, which is critical for targeting and maintenance of the Golgi apparatus. Its involvement extends to the biosynthesis of secretions, emphasizing its role in processing. TMED4 Protein, Human (HEK293, Fc) is the recombinant human-derived TMED4 protein, expressed by HEK293 , with C-mFc labeled tag.

TMED4 Protein is intricately involved in vesicular protein trafficking, particularly within the early secretory pathway, contributing to the targeting and maintenance of the Golgi apparatus. Its role extends to the biosynthesis of secreted cargo, with a specific focus on processing. Furthermore, TMED4 demonstrates involvement in the endoplasmic reticulum stress response, showcasing its significance in cellular homeostasis under stress conditions. Additionally, there is potential for TMED4 to play a role in the regulation of the heat-shock response and apoptosis, suggesting its multifaceted contributions to cellular processes beyond vesicular trafficking.

Human

HEK293

C-mFc

Q7Z7H5-1 (L30-R194)

222068  [NCBI]

Lumenal Domain

LYFHIGETEKRCFIEEIPDETMVIGNYRTQMWDKQKEVFLPSTPGLGMHVEVKDPDGKVVLSRQYGSEGRFTFTSHTPGDHQICLHSNSTRMALFAGGKLRVHLDIQVGEHANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYREERFRLTSESTNQR

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.