TMED4 Protein, Human (HEK293, His)

The TMED4 protein is complexly involved in vesicular protein trafficking in the early secretory pathway, which is critical for targeting and maintenance of the Golgi apparatus. Its involvement extends to the biosynthesis of secretions, emphasizing its role in processing. TMED4 Protein, Human (HEK293, His) is the recombinant human-derived TMED4 protein, expressed by HEK293 , with C-His labeled tag.

TMED4 Protein is intricately involved in vesicular protein trafficking, particularly within the early secretory pathway, contributing to the targeting and maintenance of the Golgi apparatus. Its role extends to the biosynthesis of secreted cargo, with a specific focus on processing. Furthermore, TMED4 demonstrates involvement in the endoplasmic reticulum stress response, showcasing its significance in cellular homeostasis under stress conditions. Additionally, there is potential for TMED4 to play a role in the regulation of the heat-shock response and apoptosis, suggesting its multifaceted contributions to cellular processes beyond vesicular trafficking.

Measured by its binding ability in a functional ELISA .Immobilized Human TMED4 at 2 μg/mL (100 μL/well) can bind Anti-TMED4 antibody, The ED₅₀ for this effect is 5.903 ng/mL.

Human

HEK293

C-His

Q7Z7H5-1 (L30-R194)

222068  [NCBI]

Lumenal Domain

LYFHIGETEKRCFIEEIPDETMVIGNYRTQMWDKQKEVFLPSTPGLGMHVEVKDPDGKVVLSRQYGSEGRFTFTSHTPGDHQICLHSNSTRMALFAGGKLRVHLDIQVGEHANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYREERFRLTSESTNQR

Approximately 23-24 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.