Copy Link Print Information

TMED4 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

The TMED4 protein is complexly involved in vesicular protein trafficking in the early secretory pathway, which is critical for targeting and maintenance of the Golgi apparatus. Its involvement extends to the biosynthesis of secretions, emphasizing its role in processing. TMED4 Protein, Human (HEK293, His) is the recombinant human-derived TMED4 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • TMED4 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The TMED4 protein is complexly involved in vesicular protein trafficking in the early secretory pathway, which is critical for targeting and maintenance of the Golgi apparatus. Its involvement extends to the biosynthesis of secretions, emphasizing its role in processing. TMED4 Protein, Human (HEK293, His) is the recombinant human-derived TMED4 protein, expressed by HEK293 , with C-His labeled tag.

Background

TMED4 Protein is intricately involved in vesicular protein trafficking, particularly within the early secretory pathway, contributing to the targeting and maintenance of the Golgi apparatus. Its role extends to the biosynthesis of secreted cargo, with a specific focus on processing. Furthermore, TMED4 demonstrates involvement in the endoplasmic reticulum stress response, showcasing its significance in cellular homeostasis under stress conditions. Additionally, there is potential for TMED4 to play a role in the regulation of the heat-shock response and apoptosis, suggesting its multifaceted contributions to cellular processes beyond vesicular trafficking.

Verified Bioactivity

Measured by its binding ability in a functional ELISA .Immobilized Human TMED4 at 2 μg/mL (100 μL/well) can bind Anti-TMED4 antibody, The ED50 for this effect is 5.903 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession

    Q7Z7H5-1 (L30-R194)

  • Gene ID
    222068  [NCBI]
  • Molecular Construction
    • N-term
    • TMED4 (L30-R194)
      Accession # Q7Z7H5-1
    • His
    • C-term
  • Protein Length

    Lumenal Domain

  • Synonyms

    TMED4; Putative NF-Kappa-B-Activating Protein 156; Transmembrane P24 Trafficking Protein 4; P24 Family Protein Alpha-3; P24alpha3; GMP25iso; P24a3; ERS25; HNLF; Endoplasmic Reticulum Stress-Response Protein 25 KDa; Transmembrane Emp24 Protein Transport Do

  • AA Sequence

    LYFHIGETEKRCFIEEIPDETMVIGNYRTQMWDKQKEVFLPSTPGLGMHVEVKDPDGKVVLSRQYGSEGRFTFTSHTPGDHQICLHSNSTRMALFAGGKLRVHLDIQVGEHANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYREERFRLTSESTNQR

  • Predicted Molecular Mass

    19.3 kDa

  • Molecular Weight

    Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • TMED4 Protein, Human (HEK293, His) Product Image
    1/16
  • TMED4 Protein, Human (HEK293, His) Product Image