1. Recombinant Proteins
  2. Others
  3. TMEM219/IGFBP-3R Protein, Human (HEK293, Fc)

The TMEM219/IGFBP-3R protein was identified as an IGFBP3-specific cell death receptor and a potential mediator of caspase-8-dependent apoptosis upon ligand binding. This protein actively binds to IGFBP3, forming a key molecular interaction that may initiate the apoptosis signaling pathway. TMEM219/IGFBP-3R Protein, Human (HEK293, Fc) is the recombinant human-derived TMEM219/IGFBP-3R protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TMEM219/IGFBP-3R protein was identified as an IGFBP3-specific cell death receptor and a potential mediator of caspase-8-dependent apoptosis upon ligand binding. This protein actively binds to IGFBP3, forming a key molecular interaction that may initiate the apoptosis signaling pathway. TMEM219/IGFBP-3R Protein, Human (HEK293, Fc) is the recombinant human-derived TMEM219/IGFBP-3R protein, expressed by HEK293 , with C-hFc labeled tag.

Background

TMEM219, also known as IGFBP-3R, serves as a cell death receptor with specificity for insulin-like growth factor binding protein 3 (IGFBP3). This receptor is implicated in potentially mediating caspase-8-dependent apoptosis upon binding with its ligand, IGFBP3. The direct interaction between TMEM219 and IGFBP3 underscores its role in transducing signals related to cell survival and death pathways. Additionally, TMEM219 interacts with caspase-8, further suggesting its involvement in regulating apoptotic processes, potentially through the caspase-8-dependent pathway.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q86XT9 (S39-R204)

Gene ID
Molecular Construction
N-term
TMEM219 (S39-R204)
Accession # Q86XT9
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
IGFBP-3R; GFBP3R; LOC124446; TMEM219
AA Sequence

SFLLTHRTGLRSPDIPQDWVSFLRSFGQLTLCPRNGTVTGKWRGSHVVGLLTTLNFGDGPDRNKTRTFQATVLGSQMGLKGSSAGQLVLITARVTTERTAGTCLYFSAVPGILPSSQPPISCSEEGAGNATLSPRMGEECVSVWSHEGLVLTKLLTSEELALCGSR

Predicted Molecular Mass
44.5 kDa
Molecular Weight

Approximately 58-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TMEM219/IGFBP-3R Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TMEM219/IGFBP-3R Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TMEM219/IGFBP-3R Protein, Human (HEK293, Fc)
Cat. No.:
HY-P77962
Quantity:
MCE Japan Authorized Agent: