1. Recombinant Proteins
  2. Others
  3. TMSB4X Protein, Human (His)

TMSB4X proteins play a critical role in cytoskeletal organization, influencing actin dynamics by binding and sequestering actin monomers. As a potent inhibitor of actin polymerization, it affects the cytoskeleton. TMSB4X Protein, Human (His) is the recombinant human-derived TMSB4X protein, expressed by E. coli , with N-6*His labeled tag. The total length of TMSB4X Protein, Human (His) is 43 a.a., with molecular weight of ~13 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TMSB4X proteins play a critical role in cytoskeletal organization, influencing actin dynamics by binding and sequestering actin monomers. As a potent inhibitor of actin polymerization, it affects the cytoskeleton. TMSB4X Protein, Human (His) is the recombinant human-derived TMSB4X protein, expressed by E. coli , with N-6*His labeled tag. The total length of TMSB4X Protein, Human (His) is 43 a.a., with molecular weight of ~13 kDa.

Background

TMSB4X protein assumes a crucial role in cytoskeletal organization, as evidenced by its documented impact on actin dynamics. It functions by binding to and sequestering actin monomers (G actin), thereby acting as a potent inhibitor of actin polymerization. Beyond its influence on the cytoskeleton, TMSB4X emerges as a robust inhibitor of bone marrow-derived stem cell differentiation, exerting its effects by impeding the entry of hematopoietic pluripotent stem cells into the S-phase. These multifaceted functions underscore the significance of TMSB4X in orchestrating fundamental cellular processes, including cytoskeletal integrity and stem cell differentiation, highlighting its regulatory role in maintaining cellular homeostasis and orchestrating dynamic cellular responses.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P62328 (S2-S44)

Gene ID
Molecular Construction
N-term
6*His
TMSB4X (S2-S44)
Accession # P62328
C-term
Synonyms
Fx; Hematopoietic system regulatory peptide; Prothymosin beta 4; PTMB 4; PTMB4; Seraspenide; T beta 4; T beta-4; TB4X; THYB 4; Thyb4; Thymosin beta 4; Thymosin beta 4 X chromosome; Thymosin beta 4 X linked; TMSB 4; TMSB4; Tmsb4x; TYB4_HUMAN
AA Sequence

SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Molecular Weight

Approximately 13 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

TMSB4X Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TMSB4X Protein, Human (His)
Cat. No.:
HY-P71930A
Quantity:
MCE Japan Authorized Agent: