TMX2 Protein, Human (His)
The TMX2 protein is an endoplasmic reticulum- and mitochondria-associated regulator that controls cellular redox status and affects post-translational modifications, protein folding, and mitochondrial activity. TMX2 Protein, Human (His) is the recombinant human-derived TMX2 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The TMX2 protein is an endoplasmic reticulum- and mitochondria-associated regulator that controls cellular redox status and affects post-translational modifications, protein folding, and mitochondrial activity. TMX2 Protein, Human (His) is the recombinant human-derived TMX2 protein, expressed by E. coli , with N-6*His labeled tag.
Background
TMX2 Protein, an endoplasmic reticulum and mitochondria-associated protein, likely serves as a crucial regulator of cellular redox state, thereby influencing protein post-translational modification, protein folding, and mitochondrial activity. This multifunctional role underscores its impact on fundamental cellular processes. TMX2's involvement in oxidative conditions enhances its homodimerization, indicating a dynamic response to the cellular redox environment. Structurally, TMX2 exists as a monomer, with the capacity to form disulfide-linked homodimers. Furthermore, it interacts with CANX and ATP2A2, suggesting potential associations with key players in cellular processes. Notably, TMX2's regulatory influence extends to neuronal proliferation, migration, and organization in the developing brain, implicating its significance in neurodevelopmental processes. The versatility of TMX2 in redox regulation and its interactions with critical cellular components emphasize its intricate role in cellular homeostasis and developmental pathways.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9Y320-1 (M125-K296)
-
Molecular Construction
-
N-term
-
6*His
-
TMX2 (M125-K296)
Accession # Q9Y320-1 -
C-term
-
-
Protein Length
Cytoplasmic Domain
-
Synonyms
TMX2; Thioredoxin Domain Containing 14, Isoform CRA_a; Prev. TXNDC14; Thioredoxin Domain Containing 14; Thioredoxin-Related Transmembrane Protein 2; Growth-Inhibiting Gene 11; Thioredoxin Domain-Containing Protein 14; NEDMCMS; PDIA12; CGI-31; Protein Disu
-
AA Sequence
MTCKPPLYMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK
-
Predicted Molecular Mass
21.9 kDa
-
Molecular Weight
Approximately 22 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
