TMX2 Protein, Human (His)

The TMX2 protein is an endoplasmic reticulum- and mitochondria-associated regulator that controls cellular redox status and affects post-translational modifications, protein folding, and mitochondrial activity. TMX2 Protein, Human (His) is the recombinant human-derived TMX2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of TMX2 Protein, Human (His) is 172 a.a., with molecular weight of ~23.0 kDa.

TMX2 Protein, an endoplasmic reticulum and mitochondria-associated protein, likely serves as a crucial regulator of cellular redox state, thereby influencing protein post-translational modification, protein folding, and mitochondrial activity. This multifunctional role underscores its impact on fundamental cellular processes. TMX2's involvement in oxidative conditions enhances its homodimerization, indicating a dynamic response to the cellular redox environment. Structurally, TMX2 exists as a monomer, with the capacity to form disulfide-linked homodimers. Furthermore, it interacts with CANX and ATP2A2, suggesting potential associations with key players in cellular processes. Notably, TMX2's regulatory influence extends to neuronal proliferation, migration, and organization in the developing brain, implicating its significance in neurodevelopmental processes. The versatility of TMX2 in redox regulation and its interactions with critical cellular components emphasize its intricate role in cellular homeostasis and developmental pathways.

Human

E. coli

N-6*His

Q9Y320 (M125-K296)

51075  [NCBI]

MTCKPPLYMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK

Approximately 23.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.