TNF RI/TNFRSF1A Protein, Human (HEK293, Fc)

The TNFR-1/CD120a protein is a receptor for TNFSF2/TNF-α and TNFSF1/lymphotoxin-α, and initiates caspase-8-mediated apoptosis upon TNF binding. It induces non-cytocidal TNF action, activates acid sphingomyelinase and establishes an antiviral state. TNFR-1/CD120a Protein, Human (HEK293, Fc) is the recombinant human-derived TNFR-1/CD120a protein, expressed by HEK293 , with C-hFc labeled tag.

TNFRSF1A (TNF RI) protein is a single-pass type I membrane protein belonging to the tumor necrosis factor (TNF) family. TNFRSF1A is the major signaling receptor for TNF-α. TNFRSF1A protein is a multifunctional cytokine, which is synthesized by almost all cells^[1][2].
The sequence of amino acids in TNFRSF1A from different species is very different (less than 85% similarity among human, rat and mouse).
TNFRSF1A contains a protein-protein interaction domain, called death domain (DD), can recruit other DD-containing proteins and couples the death receptors to caspase activation and apoptosis. Both soluble and membrane-bound forms of the cytokine can activate TNFRSF1A. TNFRSF1A induces cellular inflammatory damage and apoptosis by participating in mTOR, JNK, IKK, caspase 3, MAPK, and NF-κB pathways^[1][3][4].

Measured by its ability to inhibit the TNF-alpha mediated cytotoxicity inthe L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D.The ED₅₀ for this effect is ≤0.1558 μg/mLin the presence of 0.25 ng/mL of recombinant humanTNF-alpha, corresponding to a specific activity is ≥6.418×10³ units/mg.

• 
  Measured by its ability to inhibit the TNF-alpha mediated cytotoxicity inthe L-929 mouse fibroblast cells in the presence of the metabolic inhibitoractinomycin D.The ED₅₀ for this effect is 0.1558 μg/mLin the presence of 0.25 ng/mL of recombinant humanTNF-alpha, corresponding to a specific activity is 6.418×10³ units/mg.

Human

HEK293

C-hFc

P19438-1 (L30-T211)

7132  [NCBI]

Extracellular Domain

LVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT

Approximately 55-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<0.1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.