TNFRSF13B Protein, Mouse (HEK293, Fc)

The TNFRSF13B protein is a receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS and binds these two ligands with high affinity. It mediates calcineurin-dependent activation of NF-AT as well as NF-kappa-B and AP-1, contributing to B- and T-cell function and humoral immune regulation. TNFRSF13B Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TNFRSF13B protein, expressed by HEK293 , with C-hFc labeled tag.

The TNFRSF13B protein functions as a receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS, exhibiting high-affinity binding to both ligands. It mediates calcineurin-dependent activation of NF-AT, along with the activation of NF-kappa-B and AP-1, contributing to the stimulation of B- and T-cell function and the regulation of humoral immunity. TNFRSF13B forms associations with TRAF2, TRAF5, and TRAF6, indicating its involvement in signaling pathways. Moreover, it interacts with the NH2-terminal domain of CAMLG through its C-terminus, suggesting a role in diverse cellular processes.

Mouse

HEK293

C-hFc

Q9ET35 (F5-T129)

57916  [NCBI]

Partial

FCPKDQYWDSSRKSCVSCALTCSQRSQRTCTDFCKFINCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKRPRSQANLQPELGRPQAGEVEVRSDNSGRHQGSEHGPGLRLSSDQLTLYCT

Approximately 40-45 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.