TPO/Thrombopoietin Protein, Mouse (CHO)

TPO Protein, Mouse (CHO) is a hematopoietic factor that controls platelet production.

Recombinant thrombopoietin reduces radiation- and chemotherapy-induced thrombocytopenia, enhances platelet recovery after bone marrow transplantation and increases the number of megakaryocyte precursor cells in stem cell harvests. Injection of thrombopoietin into animals stimulates the number, size and ploidy of bone marrow megakaryocytes and increases the platelet count up to ten-fold^[1]. Superphysiological amounts of Thrombopoietin/TPO (>100 ng/mL) are able to directly activate platelet aggregation in vitro. Thrombopoietin/TPO also has significant effects on platelet adhesion under flow. Low Thrombopoietin/TPO concentrations (001-1 ng/mL) accelerate firm platelet adhesion to von Willebrand factor and prevent de-attachment at higher flow rates^[2].

The ED₅₀ is <2 ng /mL as measured by MO7e cells.

Mouse

CHO

Tag Free

P40226 (S22-T356)

21832  [NCBI]

SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKFPNRTSGLLETNFSVTARTAGPGLLSRLQGFRVKITPGQLNQTSRSPVQISGYLNRTHG

30-80 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized after extensive dialysis against PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Kuter DJ, et al. Thrombopoietin: Biology and Clinical Applications. Oncologist. 1996;1(1 & 2):98-106.  [Content Brief]

  [2]. Hitchcock IS, et al. Thrombopoietin from beginning to end. Br J Haematol. 2014 Apr;165(2):259-68.  [Content Brief]