1. Recombinant Proteins
  2. TPO Protein, Mouse (CHO)

TPO Protein, Mouse (CHO)

Cat. No.: HY-P7088
Handling Instructions

TPO Protein, Mouse (CHO) is a hematopoietic factor that controls platelet production.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $590 In-stock
Estimated Time of Arrival: December 31
100 μg $860 Get quote
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rMuTPO; TPO
Species

Mouse

Source

CHO

Accession

P40226 (S22-T356)

Gene ID

21832

Molecular Weight

30-80 kDa

AA Sequence

SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKFPNRTSGLLETNFSVTARTAGPGLLSRLQGFRVKITPGQLNQTSRSPVQISGYLNRTHG

Biological Activity
The ED50 is <2 ng /mL as measured by MO7e cells.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Recombinant thrombopoietin reduces radiation- and chemotherapy-induced thrombocytopenia, enhances platelet recovery after bone marrow transplantation and increases the number of megakaryocyte precursor cells in stem cell harvests. Injection of thrombopoietin into animals stimulates the number, size and ploidy of bone marrow megakaryocytes and increases the platelet count up to ten-fold[1]. Superphysiological amounts of Thrombopoietin/TPO (>100 ng/mL) are able to directly activate platelet aggregation in vitro. Thrombopoietin/TPO also has significant effects on platelet adhesion under flow. Low Thrombopoietin/TPO concentrations (001-1 ng/mL) accelerate firm platelet adhesion to von Willebrand factor and prevent de-attachment at higher flow rates[2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TPO Protein, Mouse (CHO)
Cat. No.:
HY-P7088
Quantity:
MCE Japan Authorized Agent: