1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TPO/Thrombopoietin Protein, Mouse (CHO)

TPO/Thrombopoietin Protein, Mouse (CHO)

Cat. No.: HY-P7088
COA Handling Instructions

TPO Protein, Mouse (CHO) is a hematopoietic factor that controls platelet production.

For research use only. We do not sell to patients.

Size Price Stock Quantity
10 μg $190 In-stock
50 μg $590 In-stock
100 μg $860 Get quote
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE TPO/Thrombopoietin Protein, Mouse (CHO)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

TPO Protein, Mouse (CHO) is a hematopoietic factor that controls platelet production.

Background

Recombinant thrombopoietin reduces radiation- and chemotherapy-induced thrombocytopenia, enhances platelet recovery after bone marrow transplantation and increases the number of megakaryocyte precursor cells in stem cell harvests. Injection of thrombopoietin into animals stimulates the number, size and ploidy of bone marrow megakaryocytes and increases the platelet count up to ten-fold[1]. Superphysiological amounts of Thrombopoietin/TPO (>100 ng/mL) are able to directly activate platelet aggregation in vitro. Thrombopoietin/TPO also has significant effects on platelet adhesion under flow. Low Thrombopoietin/TPO concentrations (001-1 ng/mL) accelerate firm platelet adhesion to von Willebrand factor and prevent de-attachment at higher flow rates[2].

Biological Activity

The ED50 is <2 ng /mL as measured by MO7e cells.

Species

Mouse

Source

CHO

Tag

Tag Free

Accession

P40226 (S22-T356)

Gene ID

21832  [NCBI]

Synonyms
rMuTPO; TPO
AA Sequence

SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKFPNRTSGLLETNFSVTARTAGPGLLSRLQGFRVKITPGQLNQTSRSPVQISGYLNRTHG

Molecular Weight

30-80 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

TPO/Thrombopoietin Protein, Mouse (CHO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TPO/Thrombopoietin Protein, Mouse (CHO)
Cat. No.:
HY-P7088
Quantity:
MCE Japan Authorized Agent: