TRMT112 Protein, Human (His-SUMO)
Based on 1 Customer Validation
TRMT112 protein activates various methyltransferases for rRNA, tRNA, and protein modifications. It cooperates with BUD23 to methylate guanine N(7) of 18S rRNA. TRMT112 Protein, Human (His-SUMO) is the recombinant human-derived TRMT112 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
TRMT112 protein activates various methyltransferases for rRNA, tRNA, and protein modifications. It cooperates with BUD23 to methylate guanine N(7) of 18S rRNA. TRMT112 Protein, Human (His-SUMO) is the recombinant human-derived TRMT112 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
Background
TRMT112 protein serves as an activator for a diverse range of methyltransferases involved in rRNA, tRNA, and protein modifications. Teaming up with methyltransferase BUD23, it methylates the N(7) position of a guanine in 18S rRNA, while in collaboration with N6AMT1/HEMK2, it catalyzes N5-methylation of ETF1 on 'Gln-185' and monomethylates 'Lys-12' of histone H4 (H4K12me1). Additionally, in conjunction with ALKBH8, TRMT112 participates in the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in specific tRNA species. Partnering with methyltransferase THUMPD3, it contributes to the formation of N(2)-methylguanosine in various tRNA substrates. Furthermore, TRMT112, along with METTL5, plays a crucial role in methylating the 6th position of adenine in position 1832 of 18S rRNA. Its involvement in pre-rRNA processing contributes to small-subunit rRNA production, and the formation of various heterodimers with BUD23, N6AMT1/HEMK2, ALKBH8, and METTL5 highlights its diverse regulatory functions in various methylation pathways. Interactions with THUMPD3, THUMPD2, and TRMT11 further underscore its intricate role in these processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His;N-SUMO
-
Accession
Q9UI30-1 (M1-S125)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
TRMT112 (M1-S125)
Accession # Q9UI30-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
TRMT112; AD-001; HSPC152; HSPC170; Multifunctional methyltransferase subunit TRM112-like protein; tRNA methyltransferase 112 homolog; TRM112; HTrm112; TRMT11-2; TRNA Methyltransferase Activator Subunit 11-2; TRM112-Like Protein; TRNA Methyltransferase 11-
-
AA Sequence
MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES
-
Predicted Molecular Mass
30.2 kDa
-
Molecular Weight
Approximately 32 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)