Troponin C/TNNC1 Protein, Human (N-His)

Troponin C, represented by the TNNC1 gene, centrally regulates striated muscle contraction. In the troponin complex consisting of Tn-I, Tn-T, and Tn-C, Tn-I inhibits the actomyosin ATPase, while Tn-T binds to tropomyosin. Troponin C/TNNC1 Protein, Human (N-His) is the recombinant human-derived Troponin C/TNNC1 protein, expressed by E. coli , with N-6*His labeled tag.

Troponin C, represented by the TNNC1 gene, serves as the central regulatory protein orchestrating striated muscle contraction. The troponin complex, composed of Tn-I, Tn-T, and Tn-C, plays a pivotal role in this regulatory mechanism. Tn-I functions as the inhibitor of actomyosin ATPase, while Tn-T provides the binding site for tropomyosin. Of particular significance, Tn-C serves as the calcium-binding component, and upon calcium interaction, it nullifies the inhibitory effect of Tn-I on actin filaments. This intricate interplay highlights the pivotal role of Troponin C in translating calcium signals into the modulation of muscle contraction dynamics.

Human

E. coli

N-6*His

P63316 (M1-E161)

7134  [NCBI]

Full Length

MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/a549-cell.html  [Content Brief]