TWSG1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The TWSG1 protein plays a dual role in BMP signaling, acting as both an antagonist and an agonist. It forms a ternary complex with CHRD and BMP, blocking BMP receptor binding, thereby antagonizing BMP signaling. TWSG1 Protein, Human (HEK293, His) is the recombinant human-derived TWSG1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The TWSG1 protein plays a dual role in BMP signaling, acting as both an antagonist and an agonist. It forms a ternary complex with CHRD and BMP, blocking BMP receptor binding, thereby antagonizing BMP signaling. TWSG1 Protein, Human (HEK293, His) is the recombinant human-derived TWSG1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
TWSG1 Protein emerges as a key participant in dorsoventral axis formation, showcasing a dual role in the modulation of BMP signaling. It appears to act as both an antagonist and an agonist, influencing BMP signaling dynamics. TWSG1 antagonizes BMP signaling by forming ternary complexes with CHRD and BMPs, thereby hindering BMPs from binding to their receptors. Concurrently, TWSG1 demonstrates pro-BMP activity, facilitated in part by the cleavage and degradation of CHRD, releasing BMPs from ternary complexes. This dual functionality suggests that TWSG1 may intricately regulate BMP-mediated processes, particularly in cartilage development and chondrocyte differentiation. Additionally, its potential role in thymocyte development implies a broader impact on cellular differentiation processes. Interactions with key partners, including CHRD, BMP4, and BMP7, further emphasize TWSG1's intricate involvement in the modulation of BMP signaling pathways. Elucidating the specific mechanisms governing TWSG1's dual actions could provide valuable insights into its multifaceted role in development and differentiation processes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9GZX9-1 (C26-F223)
-
Molecular Construction
-
N-term
-
TWSG1 (C26-F223)
Accession # Q9GZX9-1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
TWSG1; TSG; PSEC0250; Twisted gastrulation protein homolog 1; Twisted Gastrulation Homolog 1; Twisted Gastrulation Homolog 1 (Drosophila) ; Twisted Gastrulation Protein Homolog 1;
-
AA Sequence
CNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF
-
Predicted Molecular Mass
23.2 kDa
-
Molecular Weight
Approximately 35 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
