1. Recombinant Proteins
  2. Others
  3. TXN2 Protein, Human (His)

TXN2 Protein, Human (His)

Cat. No.: HY-P71393
COA Handling Instructions

As a monomer, the TXN2 protein is critical for maintaining mitochondrial reactive oxygen species (ROS) homeostasis, regulating apoptosis, and ensuring cell viability. Its unique dithiol reducing activity fine-tunes cellular redox balance, making a significant contribution to overall cellular health. TXN2 Protein, Human (His) is the recombinant human-derived TXN2 protein, expressed by E. coli , with tag free. The total length of TXN2 Protein, Human (His) is 107 a.a., with molecular weight of ~13 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $120 In-stock
50 μg $360 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

As a monomer, the TXN2 protein is critical for maintaining mitochondrial reactive oxygen species (ROS) homeostasis, regulating apoptosis, and ensuring cell viability. Its unique dithiol reducing activity fine-tunes cellular redox balance, making a significant contribution to overall cellular health. TXN2 Protein, Human (His) is the recombinant human-derived TXN2 protein, expressed by E. coli , with tag free. The total length of TXN2 Protein, Human (His) is 107 a.a., with molecular weight of ~13 kDa.

Background

The TXN2 protein plays a crucial role in maintaining the delicate balance of mitochondrial reactive oxygen species (ROS) homeostasis, governing apoptosis regulation, and ensuring cell viability. Its distinctive dithiol-reducing activity emphasizes its ability to finely tune redox equilibrium within the cellular environment, contributing significantly to overall cellular health. Operating as a monomer, TXN2 emerges as a central figure in essential cellular processes, underscoring its importance in safeguarding mitochondrial function and promoting sustained cell viability.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q99757 (T60-G166)

Gene ID
Molecular Construction
N-term
TXN2 (T60-G166)
Accession # Q99757
C-term
Synonyms
Thioredoxin Mitochondrial; MTRX; Mt-Trx; Thioredoxin-2; TXN2; TRX2
AA Sequence

TTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG

Molecular Weight

Approximately 13 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TXN2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TXN2 Protein, Human (His)
Cat. No.:
HY-P71393
Quantity:
MCE Japan Authorized Agent: