TXN2 Protein, Human
Based on 1 Customer Validation
As a monomer, the TXN2 protein is critical for maintaining mitochondrial reactive oxygen species (ROS) homeostasis, regulating apoptosis, and ensuring cell viability.Its unique dithiol reducing activity fine-tunes cellular redox balance, making a significant contribution to overall cellular health.TXN2 Protein, Human is the recombinant human-derived TXN2 protein, expressed by E.coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
As a monomer, the TXN2 protein is critical for maintaining mitochondrial reactive oxygen species (ROS) homeostasis, regulating apoptosis, and ensuring cell viability.Its unique dithiol reducing activity fine-tunes cellular redox balance, making a significant contribution to overall cellular health.TXN2 Protein, Human is the recombinant human-derived TXN2 protein, expressed by E.coli , with tag free.
The TXN2 protein plays a crucial role in maintaining the delicate balance of mitochondrial reactive oxygen species (ROS) homeostasis, governing apoptosis regulation, and ensuring cell viability. Its distinctive dithiol-reducing activity emphasizes its ability to finely tune redox equilibrium within the cellular environment, contributing significantly to overall cellular health. Operating as a monomer, TXN2 emerges as a central figure in essential cellular processes, underscoring its importance in safeguarding mitochondrial function and promoting sustained cell viability.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q99757 (T60-G166)
-
Molecular Construction
-
N-term
-
TXN2 (T60-G166)
Accession # Q99757 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
TXN2; TRX2; Thioredoxin, mitochondrial; MTRX; Mt-Trx; Thioredoxin-2; Mitochondrial Thioredoxin; TXN; COXPD29; Thioredoxin 2; MT-TRX
-
AA Sequence
TTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG
-
Predicted Molecular Mass
12 kDa
-
Molecular Weight
Approximately 13 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
