UBE2H Protein, Human (GST)

UBE2H Protein, a crucial participant in cellular ubiquitination, transfers ubiquitin from the E1 complex to various proteins, including MAEA of the CTLH E3 ubiquitin-protein ligase complex. Versatile in vitro, UBE2H catalyzes both 'Lys-11'- and 'Lys-48'-linked polyubiquitination, showcasing its involvement in diverse ubiquitin-related processes. Notably, it demonstrates the capability to ubiquitinate histone H2A in vitro. UBE2H Protein, Human (GST) is the recombinant human-derived UBE2H protein, expressed by E. coli, with N-GST labeled tag. The total length of UBE2H Protein, Human (GST) is 183 a.a., with molecular weight of ~50.0 kDa.

UBE2H, a crucial participant in cellular ubiquitination processes, plays a pivotal role in the transfer of ubiquitin from the E1 complex to various proteins. Particularly noteworthy is its ability to transfer ubiquitin to MAEA, a core component of the CTLH E3 ubiquitin-protein ligase complex. In vitro studies demonstrate UBE2H's versatility as it catalyzes both 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Additionally, UBE2H exhibits the capability to ubiquitinate histone H2A in vitro, highlighting its involvement in diverse ubiquitin-related processes.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-GST

P62256 (M1-L183)

7328  [NCBI]

MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL

Approximately 50.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 50 mM HEPES, 150 mM NaCl, 2 mM DTT, 10% Glycerol, pH 7.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.