UCMA Protein, Human

UCMA proteins are key regulators of the complex control of osteogenic differentiation, particularly in the fetal cartilage periphery and at the cartilage-bone interface. Its involvement suggests a crucial role in negatively regulating osteochondral precursor cell differentiation. UCMA Protein, Human is the recombinant human-derived UCMA protein, expressed by E. coli , with tag free. The total length of UCMA Protein, Human is 74 a.a., with molecular weight of ~14.0 kDa.

UCMA Protein emerges as a potential key player in the intricate regulation of osteogenic differentiation, particularly within the peripheral zones of fetal cartilage and at the cartilage-bone interface. Its involvement suggests a crucial role in exerting negative control over the differentiation processes of osteochondrogenic precursor cells. UCMA's regulatory impact within these specific anatomical regions underscores its significance in modulating the delicate balance of cellular differentiation, with potential implications for skeletal development and homeostasis. Unraveling the precise mechanisms by which UCMA exerts its negative control on osteogenic differentiation could provide valuable insights into its functional significance and contribute to a deeper understanding of the molecular pathways governing skeletal tissue development and maintenance.

Human

E. coli

Tag Free

Q8WVF2 (S65-T138)

221044  [NCBI]

SPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT

Approximately 14.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.