UCMA Protein, Human
UCMA proteins are key regulators of the complex control of osteogenic differentiation, particularly in the fetal cartilage periphery and at the cartilage-bone interface. Its involvement suggests a crucial role in negatively regulating osteochondral precursor cell differentiation. UCMA Protein, Human is the recombinant human-derived UCMA protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
UCMA proteins are key regulators of the complex control of osteogenic differentiation, particularly in the fetal cartilage periphery and at the cartilage-bone interface. Its involvement suggests a crucial role in negatively regulating osteochondral precursor cell differentiation. UCMA Protein, Human is the recombinant human-derived UCMA protein, expressed by E. coli , with tag free.
UCMA Protein emerges as a potential key player in the intricate regulation of osteogenic differentiation, particularly within the peripheral zones of fetal cartilage and at the cartilage-bone interface. Its involvement suggests a crucial role in exerting negative control over the differentiation processes of osteochondrogenic precursor cells. UCMA's regulatory impact within these specific anatomical regions underscores its significance in modulating the delicate balance of cellular differentiation, with potential implications for skeletal development and homeostasis. Unraveling the precise mechanisms by which UCMA exerts its negative control on osteogenic differentiation could provide valuable insights into its functional significance and contribute to a deeper understanding of the molecular pathways governing skeletal tissue development and maintenance.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q8WVF2 (S65-T138)
-
Molecular Construction
-
N-term
-
UCMA (S65-T138)
Accession # Q8WVF2 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Unique cartilage matrix-associated protein; UCMA; Gla-rich protein; C10orf49
-
AA Sequence
SPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT
-
Predicted Molecular Mass
9.8 kDa
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
