Copy Link Print Information

UGRP1 Protein, Human

Customer Review

Based on 1 Customer Validation

UGRP1, a secreted cytokine-like protein, interacts with pathogens (L.monocytogenes, P.aeruginosa, yeast) and binds to MARCO. It strongly inhibits PLA2G1B activity, exerting anti-inflammatory and anti-fibrotic effects in the lung. UGRP1 may contribute to fetal lung development, inhibits FSH and LH production in the pituitary, and interacts with APOA1. Structurally, UGRP1 exists as a homodimer, with diverse physiological roles. UGRP1 Protein, Human is the recombinant human-derived UGRP1 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • UGRP1 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

UGRP1, a secreted cytokine-like protein, interacts with pathogens (L.monocytogenes, P.aeruginosa, yeast) and binds to MARCO. It strongly inhibits PLA2G1B activity, exerting anti-inflammatory and anti-fibrotic effects in the lung. UGRP1 may contribute to fetal lung development, inhibits FSH and LH production in the pituitary, and interacts with APOA1. Structurally, UGRP1 exists as a homodimer, with diverse physiological roles. UGRP1 Protein, Human is the recombinant human-derived UGRP1 protein, expressed by E. coli , with tag free.

Background

UGRP1 is a secreted cytokine-like protein with a broad range of functions. It binds to the scavenger receptor MARCO and exhibits binding capabilities to various pathogens, including the Gram-positive bacterium L.monocytogenes, the Gram-negative bacterium P.aeruginosa, and yeast. Additionally, UGRP1 strongly inhibits phospholipase A2 (PLA2G1B) activity and appears to exert anti-inflammatory effects in respiratory epithelium. Moreover, it demonstrates anti-fibrotic activity in the lung and may play a role in fetal lung development and maturation, actively promoting branching morphogenesis during the early stages of lung development. In the pituitary, UGRP1 is suggested to potentially inhibit the production of follicle-stimulating hormone (FSH) and luteinizing hormone (LH). Structurally, UGRP1 exists as a homodimer, held together by disulfide bonds, and can also function as a monomer. Furthermore, it interacts with APOA1, adding another layer to its involvement in diverse physiological processes.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    Q96PL1 ( F22-V93)

  • Gene ID
    117156  [NCBI]
  • Molecular Construction
    • N-term
    • UGRP1 ( F22-V93)
      Accession # Q96PL1
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    SCGB3A2; Pneumo Secretory Protein 1; Secretoglobin Family 3A Member 2; LU103; UGRP1; Uteroglobin Related Protein 1; PNSP1; PnSP-1; Uteroglobin-Related Protein 1; Secretoglobin, Family 3A, Member 2

  • AA Sequence

    FLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV

  • Predicted Molecular Mass

    7.9 kDa

  • Molecular Weight

    Approximately 6 kDa kDa & 7 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • UGRP1 Protein, Human Product Image
    1/16
  • UGRP1 Protein, Human Product Image