UHRF2 Protein, Human (His, SUMO)

UHRF2 protein is an E3 ubiquitin ligase involved in DNA methylation, histone modification, cell cycle regulation and DNA repair. UHRF2 Protein, Human (His, SUMO) is the recombinant human-derived UHRF2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

UHRF2, an E3 ubiquitin ligase, plays pivotal roles in orchestrating DNA methylation, histone modifications, cell cycle progression, and DNA repair processes. As a specific reader for 5-hydroxymethylcytosine (5hmC), UHRF2 recruits various substrates to these genomic sites, facilitating their ubiquitination and ensuring the maintenance of 5mC levels at specific loci, thereby regulating neuron-related gene expression. In the realm of cell cycle regulation, UHRF2 exerts control by ubiquitinating cyclins CCND1 and CCNE1, leading to G1 arrest. It also targets PCNP for ubiquitin-mediated degradation by the proteasome. Functioning as a key player in DNA damage response, UHRF2 ubiquitinates p21/CDKN1A, promoting its proteasomal degradation and actively participating in DNA repair. Acting as an interstrand cross-links (ICLs) sensor, UHRF2 collaborates with UHRF1 to recruit FANCD2 to ICLs, resulting in FANCD2 monoubiquitination and subsequent activation. Furthermore, UHRF2 contributes to the UV-induced DNA damage response by physically interacting with ATR upon irradiation, thereby facilitating ATR activation.

Human

E. coli

N-6*His;N-SUMO

Q96PU4 (T419-K648)

115426

Partial

STESRRDWGRGMACVGRTRECTIVPSNHYGPIPGIPVGSTWRFRVQVSEAGVHRPHVGGIHGRSNDGAYSLVLAGGFADEVDRGDEFTYTGSGGKNLAGNKRIGAPSADQTLTNMNRALALNCDAPLDDKIGAESRNWRAGKPVRVIRSFKGRKISKYAPEEGNRYDGIYKVVKYWPEISSSHGFLVWRYLLRRDDVEPAPWTSEGIERSRRLCLRLQYPAGYPSDKEGK

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.