1. Recombinant Proteins
  2. Enzymes & Regulators Ubiquitin Related Proteins
  3. Transferases (EC 2) Ubiquitin Enzymes
  4. E3 Ligases
  5. UHRF2 Protein, Human (His, SUMO)

UHRF2 protein is an E3 ubiquitin ligase involved in DNA methylation, histone modification, cell cycle regulation and DNA repair. UHRF2 Protein, Human (His, SUMO) is the recombinant human-derived UHRF2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

UHRF2 protein is an E3 ubiquitin ligase involved in DNA methylation, histone modification, cell cycle regulation and DNA repair. UHRF2 Protein, Human (His, SUMO) is the recombinant human-derived UHRF2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Background

UHRF2, an E3 ubiquitin ligase, plays pivotal roles in orchestrating DNA methylation, histone modifications, cell cycle progression, and DNA repair processes. As a specific reader for 5-hydroxymethylcytosine (5hmC), UHRF2 recruits various substrates to these genomic sites, facilitating their ubiquitination and ensuring the maintenance of 5mC levels at specific loci, thereby regulating neuron-related gene expression. In the realm of cell cycle regulation, UHRF2 exerts control by ubiquitinating cyclins CCND1 and CCNE1, leading to G1 arrest. It also targets PCNP for ubiquitin-mediated degradation by the proteasome. Functioning as a key player in DNA damage response, UHRF2 ubiquitinates p21/CDKN1A, promoting its proteasomal degradation and actively participating in DNA repair. Acting as an interstrand cross-links (ICLs) sensor, UHRF2 collaborates with UHRF1 to recruit FANCD2 to ICLs, resulting in FANCD2 monoubiquitination and subsequent activation. Furthermore, UHRF2 contributes to the UV-induced DNA damage response by physically interacting with ATR upon irradiation, thereby facilitating ATR activation.

Species

Human

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

Q96PU4 (T419-K648)

Gene ID

115426

Molecular Construction
N-term
6*His-SUMO
UHRF2 (T419-K648)
Accession # Q96PU4
C-term
Protein Length

Partial

Synonyms
UHRF2; E3 ubiquitin-protein ligase UHRF2; Np95/ICBP90-like RING finger protein; Np95-like RING finger protein; Nuclear protein 97; Nuclear zinc finger protein Np97; RING finger protein 107; RING-type E3 ubiquitin transferase UHRF2; Ubiquitin-like PHD and RING finger domain-containing protein 2; Ubiquitin-like-containing PHD and RING finger domains protein 2
AA Sequence

STESRRDWGRGMACVGRTRECTIVPSNHYGPIPGIPVGSTWRFRVQVSEAGVHRPHVGGIHGRSNDGAYSLVLAGGFADEVDRGDEFTYTGSGGKNLAGNKRIGAPSADQTLTNMNRALALNCDAPLDDKIGAESRNWRAGKPVRVIRSFKGRKISKYAPEEGNRYDGIYKVVKYWPEISSSHGFLVWRYLLRRDDVEPAPWTSEGIERSRRLCLRLQYPAGYPSDKEGK

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

UHRF2 Protein, Human (His, SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

UHRF2 Protein, Human (His, SUMO)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UHRF2 Protein, Human (His, SUMO)
Cat. No.:
HY-P701516
Quantity:
MCE Japan Authorized Agent: