uPAR Protein, Mouse (HEK293, His)

The uPAR protein acts as a receptor for urokinase plasminogen activator, facilitating plasmin formation and signal transduction activation.It interacts with SRPX2 and forms a monomer.uPAR also interacts with MRC2 and SORL1, reducing PLAUR internalization.Additionally, the PLAUR-PLAU-SERPINE1 complex interacts with SORL1.uPAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived uPAR protein, expressed by HEK293 , with C-His labeled tag.

The uPAR protein functions as a receptor for urokinase plasminogen activator and plays a crucial role in localizing and facilitating the formation of plasmin. Additionally, it mediates signal transduction activation effects of U-PA independently of proteolysis. It is predominantly found as a monomer and interacts with SRPX2 through its UPAR/Ly6 domains. uPAR also interacts with MRC2 and SORL1, with the latter interaction reducing PLAUR internalization. Moreover, the ternary complex consisting of PLAUR-PLAU-SERPINE1 also interacts with SORL1.

Recombinant Mouse PLAUR / CD87 / uPAR Protein (His Tag) immobilized on CM5 chip, can bind Recombinant Human Urokinase / PLAU Protein (His Tag) with an affinity constant of 9.79 nM as determined in an SPR assay (Biacore 8K).

Mouse

HEK293

C-His

P35456-1/NP_035243.1 (L24-T297)

18793  [NCBI]

Partial

LQCMQCESNQSCLVEECALGQDLCRTTVLREWQDDRELEVVTRGCAHSEKTNRTMSYRMGSMIISLTETVCATNLCNRPRPGARGRAFPQGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSLKDEDYTRGCGSLPGCPGTAGFHSNQTFHFLKCCNYTHCNGGPVLDLQSFPPNGFQCYSCEGNNTLGCSSEEASLINCRGPMNQCLVATGLDVLGNRSYTVRGCATASWCQGSHVADSFPTHLNVSVSCCHGSGCNSPT

50-60 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween-80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.