UQCRH Protein, Human (GST)
Based on 1 Customer Validation
UQCRH is an important component of the mitochondrial electron transport chain and contributes to oxidative phosphorylation within the ubiquinol-cytochrome c oxidoreductase complex. It operates in the respiratory chain, transferring electrons from NADH and succinate to molecular oxygen, establishing an electrochemical gradient for ATP synthesis. UQCRH Protein, Human (GST) is the recombinant human-derived UQCRH protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
UQCRH is an important component of the mitochondrial electron transport chain and contributes to oxidative phosphorylation within the ubiquinol-cytochrome c oxidoreductase complex. It operates in the respiratory chain, transferring electrons from NADH and succinate to molecular oxygen, establishing an electrochemical gradient for ATP synthesis. UQCRH Protein, Human (GST) is the recombinant human-derived UQCRH protein, expressed by E. coli , with N-GST labeled tag.
Background
UQCRH, a vital constituent of the ubiquinol-cytochrome c oxidoreductase, is a key component of the mitochondrial electron transport chain essential for oxidative phosphorylation. As part of the respiratory chain, which includes succinate dehydrogenase (complex II), ubiquinol-cytochrome c oxidoreductase (complex III), and cytochrome c oxidase (complex IV), UQCRH collaborates in transferring electrons from NADH and succinate to molecular oxygen, establishing an electrochemical gradient across the inner membrane to drive ATP synthase and transmembrane transport. Operating within the cytochrome b-c1 complex, UQCRH catalyzes the transfer of electrons from ubiquinol to cytochrome c, coupling this redox reaction with the translocation of protons across the mitochondrial inner membrane. In the Q cycle process, protons are consumed from the matrix, released into the intermembrane space, and electrons are passed to cytochrome c. UQCRH is a component of the multisubunit ubiquinol-cytochrome c oxidoreductase complex, comprised of various subunits, including respiratory and core proteins, forming obligatory dimers and supercomplexes in the inner mitochondrial membrane with other respiratory complexes like NADH-ubiquinone oxidoreductase (complex I) and cytochrome c oxidase (complex IV).
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
P07919 (M1-K91)
-
Molecular Construction
-
N-term
-
GST
-
UQCRH (M1-K91)
Accession # P07919 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
UQCRH; Ubiquinol-Cytochrome C Reductase Hinge Protein; UQCR8; QCR6; Ubiquinol-Cytochrome C Reductase, Complex III Subunit VIII; Ubiquinol-Cytochrome C Reductase Complex 11 KDa Protein; Cytochrome B-C1 Complex Subunit 6, Mitochondrial; Cytochrome C1 Non-He
-
AA Sequence
MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK
-
Predicted Molecular Mass
37.5 kDa
-
Molecular Weight
Approximately 31-55 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)