UQCRH Protein, Human (GST)

Customer Review

Based on 1 Customer Validation

UQCRH is an important component of the mitochondrial electron transport chain and contributes to oxidative phosphorylation within the ubiquinol-cytochrome c oxidoreductase complex. It operates in the respiratory chain, transferring electrons from NADH and succinate to molecular oxygen, establishing an electrochemical gradient for ATP synthesis. UQCRH Protein, Human (GST) is the recombinant human-derived UQCRH protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

UQCRH is an important component of the mitochondrial electron transport chain and contributes to oxidative phosphorylation within the ubiquinol-cytochrome c oxidoreductase complex. It operates in the respiratory chain, transferring electrons from NADH and succinate to molecular oxygen, establishing an electrochemical gradient for ATP synthesis. UQCRH Protein, Human (GST) is the recombinant human-derived UQCRH protein, expressed by E. coli , with N-GST labeled tag.

Background

UQCRH, a vital constituent of the ubiquinol-cytochrome c oxidoreductase, is a key component of the mitochondrial electron transport chain essential for oxidative phosphorylation. As part of the respiratory chain, which includes succinate dehydrogenase (complex II), ubiquinol-cytochrome c oxidoreductase (complex III), and cytochrome c oxidase (complex IV), UQCRH collaborates in transferring electrons from NADH and succinate to molecular oxygen, establishing an electrochemical gradient across the inner membrane to drive ATP synthase and transmembrane transport. Operating within the cytochrome b-c1 complex, UQCRH catalyzes the transfer of electrons from ubiquinol to cytochrome c, coupling this redox reaction with the translocation of protons across the mitochondrial inner membrane. In the Q cycle process, protons are consumed from the matrix, released into the intermembrane space, and electrons are passed to cytochrome c. UQCRH is a component of the multisubunit ubiquinol-cytochrome c oxidoreductase complex, comprised of various subunits, including respiratory and core proteins, forming obligatory dimers and supercomplexes in the inner mitochondrial membrane with other respiratory complexes like NADH-ubiquinone oxidoreductase (complex I) and cytochrome c oxidase (complex IV).

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GST
    • UQCRH (M1-K91)
      Accession # P07919
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    UQCRH; Ubiquinol-Cytochrome C Reductase Hinge Protein; UQCR8; QCR6; Ubiquinol-Cytochrome C Reductase, Complex III Subunit VIII; Ubiquinol-Cytochrome C Reductase Complex 11 KDa Protein; Cytochrome B-C1 Complex Subunit 6, Mitochondrial; Cytochrome C1 Non-He

  • AA Sequence

    MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK

  • Predicted Molecular Mass

    37.5 kDa

  • Molecular Weight

    Approximately 31-55 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00