VAMP3 Protein, Human (His)
Based on 1 Customer Validation
VAMP3 protein is an important SNARE protein that promotes vesicle transport from late endosomes to the trans-Golgi network. Its interaction with BVES, mediated by its C-terminal cytoplasmic tail, is crucial in this process. VAMP3 Protein, Human (His) is the recombinant human-derived VAMP3 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
VAMP3 protein is an important SNARE protein that promotes vesicle transport from late endosomes to the trans-Golgi network. Its interaction with BVES, mediated by its C-terminal cytoplasmic tail, is crucial in this process. VAMP3 Protein, Human (His) is the recombinant human-derived VAMP3 protein, expressed by E. coli , with N-His labeled tag.
VAMP3, a critical SNARE protein, plays a key role in orchestrating vesicular transport from late endosomes to the trans-Golgi network. The interaction with BVES, facilitated through its C-terminus cytoplasmic tail, assumes significance in this transport process. Moreover, VAMP3 collaborates with BCAP31, contributing to the efficient export of VAMP3 from the endoplasmic reticulum. Notably, the association with BAIAP3 is subject to modulation by calcium, revealing a nuanced regulatory aspect. In addition to these interactions, VAMP3 engages with PICALM, further underscoring the intricate network of molecular associations governing its diverse cellular functions.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-10*His
-
Accession
Q15836 (M1-K77)
-
Molecular Construction
-
N-term
-
His
-
VAMP3 (M1-K77)
Accession # Q15836 -
C-term
-
-
Protein Length
Partial
-
Synonyms
VAMP3; Vesicle Associated Membrane Protein 3; CEB; Cellubrevin; Vesicle‑Associated Membrane Protein 3; Synaptobrevin‑3; Vesicle‑Associated Membrane Protein 3 (Cellubrevin); VAMP3 Protein; VAMP‑3; SYB3
-
AA Sequence
MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCK
-
Predicted Molecular Mass
8.7 kDa
-
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (233 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
