1. Recombinant Proteins
  2. Others
  3. VAMP3 Protein, Human (His)

VAMP3 Protein, Human (His)

Cat. No.: HY-P76121
COA Handling Instructions

VAMP3 protein is an important SNARE protein that promotes vesicle transport from late endosomes to the trans-Golgi network. Its interaction with BVES, mediated by its C-terminal cytoplasmic tail, is crucial in this process. VAMP3 Protein, Human (His) is the recombinant human-derived VAMP3 protein, expressed by E. coli , with N-His labeled tag. The total length of VAMP3 Protein, Human (His) is 77 a.a., with molecular weight of ~11 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $50 In-stock
10 μg $85 In-stock
50 μg $220 In-stock
100 μg $350 In-stock
500 μg $945 In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

VAMP3 protein is an important SNARE protein that promotes vesicle transport from late endosomes to the trans-Golgi network. Its interaction with BVES, mediated by its C-terminal cytoplasmic tail, is crucial in this process. VAMP3 Protein, Human (His) is the recombinant human-derived VAMP3 protein, expressed by E. coli , with N-His labeled tag. The total length of VAMP3 Protein, Human (His) is 77 a.a., with molecular weight of ~11 kDa.

Background

VAMP3, a critical SNARE protein, plays a key role in orchestrating vesicular transport from late endosomes to the trans-Golgi network. The interaction with BVES, facilitated through its C-terminus cytoplasmic tail, assumes significance in this transport process. Moreover, VAMP3 collaborates with BCAP31, contributing to the efficient export of VAMP3 from the endoplasmic reticulum. Notably, the association with BAIAP3 is subject to modulation by calcium, revealing a nuanced regulatory aspect. In addition to these interactions, VAMP3 engages with PICALM, further underscoring the intricate network of molecular associations governing its diverse cellular functions.

Species

Human

Source

E. coli

Tag

N-10*His

Accession

Q15836 (M1-K77)

Gene ID
Molecular Construction
N-term
His
VAMP3 (M1-K77)
Accession # Q15836
C-term
Synonyms
Vesicle-associated membrane protein 3; VAMP-3; Cellubrevin; CEB; Synaptobrevin-3; VAMP3; SYB3
AA Sequence

MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCK

Molecular Weight

Approximately 12 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

VAMP3 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VAMP3 Protein, Human (His)
Cat. No.:
HY-P76121
Quantity:
MCE Japan Authorized Agent: