Vinculin Protein, Human (GST)
Vinculin Protein, an actin-binding protein, is crucial for cell adhesion, morphology, and mechanosensing. It regulates E-cadherin expression and enhances mechanosensing. Vinculin forms complexes with THSD1, PTK2/FAK1, TLN1, and VCL, and interacts with APBB1IP, NRAP, CTNNB1, SYNM, SORBS1, and CTNNA1. Its interaction with CTNNA1 is necessary for localization to cell-cell junctions. Vinculin also binds to ACTN4, causing conformational changes. Vinculin Protein, Human (GST) is the recombinant human-derived Vinculin protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Vinculin Protein, an actin-binding protein, is crucial for cell adhesion, morphology, and mechanosensing. It regulates E-cadherin expression and enhances mechanosensing. Vinculin forms complexes with THSD1, PTK2/FAK1, TLN1, and VCL, and interacts with APBB1IP, NRAP, CTNNB1, SYNM, SORBS1, and CTNNA1. Its interaction with CTNNA1 is necessary for localization to cell-cell junctions. Vinculin also binds to ACTN4, causing conformational changes. Vinculin Protein, Human (GST) is the recombinant human-derived Vinculin protein, expressed by E. coli , with N-GST labeled tag.
Vinculin Protein, an actin filament (F-actin)-binding protein, is extensively involved in cell-matrix adhesion and cell-cell adhesion, playing crucial roles in cell morphology, locomotion, and mechanosensing. It regulates the expression of cell-surface E-cadherin and enhances mechanosensing through the E-cadherin complex. Vinculin exhibits self-association properties and forms a complex with THSD1, PTK2/FAK1, TLN1, and VCL. It interacts with APBB1IP, NRAP, TLN1, CTNNB1, SYNM, SORBS1, and CTNNA1, and its interaction with CTNNA1 is necessary for its localization to cell-cell junctions and regulation of E-cadherin expression. Additionally, Vinculin binds to ACTN4, triggering conformational changes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
P18206 (P2-E235)
-
Molecular Construction
-
N-term
-
GST
-
Vinculin (P2-E235)
Accession # P18206 -
C-term
-
-
Protein Length
Partial
-
Synonyms
VCL; Vinculin; Metavinculin; VINC; MV; Epididymis Secretory Sperm Binding Protein; Epididymis Luminal Protein 114; Meta‑Vinculin; HEL114; CMD1W; CMH15; MVCL
-
AA Sequence
PVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVE
-
Predicted Molecular Mass
53 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
