Copy Link Print Information

VEGF-D Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

VEGF-D protein is a potent growth factor in angiogenesis, lymphangiogenesis, and endothelial cell growth, playing a key role in stimulating cell proliferation, migration, and affecting vascular permeability. It may be involved in the formation of veins and lymphatic vasculature during embryogenesis, suggesting that it plays a key role in vascular development. VEGF-D Protein, Human (HEK293, His) is the recombinant human-derived VEGF-D protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for VEGF-D Protein, Human (HEK293, His)
  • Experimental Validation Results for VEGF-D Protein, Human (HEK293, His)
  • VEGF-D Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

VEGF-D protein is a potent growth factor in angiogenesis, lymphangiogenesis, and endothelial cell growth, playing a key role in stimulating cell proliferation, migration, and affecting vascular permeability. It may be involved in the formation of veins and lymphatic vasculature during embryogenesis, suggesting that it plays a key role in vascular development. VEGF-D Protein, Human (HEK293, His) is the recombinant human-derived VEGF-D protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The VEGF-DD Protein, a growth factor with prominent activity in angiogenesis, lymphangiogenesis, and endothelial cell growth, plays a pivotal role in stimulating the proliferation and migration of these cells, while also influencing blood vessel permeability. Its potential involvement in the formation of both venous and lymphatic vascular systems during embryogenesis suggests a critical role in vascular development. Additionally, VEGF-DD may contribute to the maintenance of differentiated lymphatic endothelium in adults. The protein achieves these effects through binding and activation of VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors. Structurally, VEGF-DD exists as a homodimer, displaying a non-covalent and antiparallel arrangement, highlighting its multifaceted role in regulating vascular processes and underscoring its importance in both developmental and adult angiogenesis and lymphangiogenesis.

Verified Bioactivity

Measured in a cell proliferation assay using HUVEC cells. The ED50 for this effect is 0.42 μg/mL, corresponding to a specific activity is 2.38×104 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using HUVEC cells. The ED50 for this effect is 0.42 μg/mL, corresponding to a specific activity is 2.38×104 U/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    O43915 (F93-S201)

  • Gene ID
    2277  [NCBI]
  • Molecular Construction
    • N-term
    • VEGF-DD (F93-S201)
      Accession # O43915
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    VEGFD; Vascular Endothelial Growth Factor D; FIGF; VEGF-D; C-Fos Induced Growth Factor (Vascular Endothelial Growth Factor D); C-Fos-Induced Growth Factor

  • AA Sequence

    FYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYS

  • Predicted Molecular Mass

    13 kDa

  • Molecular Weight

    Approximately 18-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using HUVEC cells. The ED50 for this effect is 0.42 μg/mL, corresponding to a specific activity is 2.38×104 U/mg.

  • VEGF-D Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for VEGF-D Protein, Human (HEK293, His)
  • Experimental Validation Results for VEGF-D Protein, Human (HEK293, His)
  • VEGF-D Protein, Human (HEK293, His) Product Image