VEGF-D Protein, Human (117a.a, HEK293, His)

VEGF-DD protein is a potent growth factor in angiogenesis, lymphangiogenesis, and endothelial cell growth, playing a key role in stimulating cell proliferation, migration, and affecting vascular permeability. It may be involved in the formation of veins and lymphatic vasculature during embryogenesis, suggesting that it plays a key role in vascular development. VEGF-D Protein, Human (117a.a, HEK293, His) is the recombinant human-derived VEGF-D protein, expressed by HEK293, with C-His labeled tag.

The VEGF-DD Protein, a growth factor with prominent activity in angiogenesis, lymphangiogenesis, and endothelial cell growth, plays a pivotal role in stimulating the proliferation and migration of these cells, while also influencing blood vessel permeability. Its potential involvement in the formation of both venous and lymphatic vascular systems during embryogenesis suggests a critical role in vascular development. Additionally, VEGF-DD may contribute to the maintenance of differentiated lymphatic endothelium in adults. The protein achieves these effects through binding and activation of VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors. Structurally, VEGF-DD exists as a homodimer, displaying a non-covalent and antiparallel arrangement, highlighting its multifaceted role in regulating vascular processes and underscoring its importance in both developmental and adult angiogenesis and lymphangiogenesis.

Human

HEK293

C-8*His

O43915 (F89-R205)

2277

Partial

FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR

Approximately 23-43 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.