Copy Link Print Information

VEGF165 Protein, Human (P.pastoris)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

VEGF165 Protein, Human (P.pastoris) is a Vascular Endothelial Growth Factor A (VEGF-A) isoform. VEGF is a heparin-binding growth factor specific for vascular endothelial cells that is able to induce angiogenesis.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for VEGF165 Protein, Human (P.pastoris)
  • VEGF165 Protein, Human (P.pastoris) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

VEGF165 Protein, Human (P.pastoris) is a Vascular Endothelial Growth Factor A (VEGF-A) isoform. VEGF is a heparin-binding growth factor specific for vascular endothelial cells that is able to induce angiogenesis.

Background

Vascular Endothelial Growth Factor (VEGF) has multiple isoforms, created by alternative splicing or proteolytic cleavage, and characterized by different receptor-binding and matrix-binding properties. These isoforms are known to give rise to a spectrum of angiogenesis patterns marked by differences in branching, which has functional implications for tissues. VEGF-A is a key member of the VEGF family of cytokines, along with VEGF-B, -C, -D, and PlGF. VEGF-A mediates angiogenesis, the expansion of an existing vascular bed by sprouting of new blood vessels. The vegfa gene is translated into a number of splice isoforms, the most notable in humans being VEGF121, VEGF165, and VEGF189[1].

Verified Bioactivity

The ED50 is <5 ng/mL as measured by HUVEC cells, corresponding to a specific activity of 2 × 105 - 1 × 106 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source P. pastoris
  • Tag Tag Free
  • Accession

    P15692-4 (A27-R191)

  • Gene ID
    7422  [NCBI]
  • Molecular Construction
    • N-term
    • VEGF165 (A27-R191)
      Accession # P15692-4
    • C-term
  • Protein Length

    Full Length of Isoform-4

  • Synonyms

    VEGFA; Vascular Endothelial Growth Factor A; VEGF; VPF; Vascular Permeability Factor; Vascular Endothelial Growth Factor A, Long Form; VEGF-A; L-VEGF; Vascular Endothelial Growth Factor A121; Vascular Endothelial Growth Factor A165; Vascular Endothelial G

  • AA Sequence

    APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

  • Predicted Molecular Mass

    19.2 kDa

  • Molecular Weight

    Approximately 18-20 kDa under reduced (R) conditions, 38-40 kDa under non reducing (N) conditions, based on SDS-PAGE.

  • Structure/Form

    Homodimer

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 25 mM HEPES and 150 mM NaCl, pH 7.0.

Endotoxin Level

<0.5 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Vempati P, et al. Extracellular regulation of VEGF: isoforms, proteolysis, and vascular patterning. Cytokine Growth Factor Rev. 2014 Feb;25(1):1-19. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • VEGF165 Protein, Human (P.pastoris) Product Image
    1/16
  • Experimental Validation Results for VEGF165 Protein, Human (P.pastoris)
  • VEGF165 Protein, Human (P.pastoris) Product Image