1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. VEGF & VEGFR
  4. VEGF
  5. VEGF-A
  6. VEGF165 Protein, Human (P.pastoris)

VEGF165 Protein, Human (P.pastoris)

Cat. No.: HY-P7110
COA Handling Instructions

VEGF165 Protein, Human (P.pastoris) is a Vascular Endothelial Growth Factor A (VEGF-A) isoform. VEGF is a heparin-binding growth factor specific for vascular endothelial cells that is able to induce angiogenesis.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $160 In-stock
50 μg $410 In-stock
100 μg $680 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

VEGF165 Protein, Human (P.pastoris) is a Vascular Endothelial Growth Factor A (VEGF-A) isoform. VEGF is a heparin-binding growth factor specific for vascular endothelial cells that is able to induce angiogenesis.

Background

Vascular Endothelial Growth Factor (VEGF) has multiple isoforms, created by alternative splicing or proteolytic cleavage, and characterized by different receptor-binding and matrix-binding properties. These isoforms are known to give rise to a spectrum of angiogenesis patterns marked by differences in branching, which has functional implications for tissues. VEGF-A is a key member of the VEGF family of cytokines, along with VEGF-B, -C, -D, and PlGF. VEGF-A mediates angiogenesis, the expansion of an existing vascular bed by sprouting of new blood vessels. The vegfa gene is translated into a number of splice isoforms, the most notable in humans being VEGF121, VEGF165, and VEGF189[1].

Biological Activity

The ED50 is 1-5 ng/mL as measured by HUVEC cells, corresponding to a specific activity of 2 × 105 - 1 × 106 units/mg.

Species

Human

Source

P. pastoris

Tag

Tag Free

Accession

P15692-4 (A27-R191)

Gene ID
Molecular Construction
N-term
VEGF165 (A27-R191)
Accession # P15692-4
C-term
Synonyms
VEGF-AA; rHuVEGF165; VPF; Folliculostellate cell-derived growth factor; Glioma-derived endothelial cell mitogen
AA Sequence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Molecular Weight

Approximately 38.2 kDa (Disulfide-linked homodimer)

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against 25 mM HEPES and 150 mM NaCl, pH 7.0.

Endotoxin Level

<0.5 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

VEGF165 Protein, Human (P.pastoris) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VEGF165 Protein, Human (P.pastoris)
Cat. No.:
HY-P7110
Quantity:
MCE Japan Authorized Agent: