1. Recombinant Proteins
  2. VEGF165 Protein, Mouse

VEGF165 Protein, Mouse

Cat. No.: HY-P7312
Handling Instructions

VEGF165 Protein, Mouse is a potent mediator of angiogenesis and binds the semaphorin receptor, neuropilin1.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $220 In-stock
Estimated Time of Arrival: December 31
50 μg $660 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rMuVEGF165; VEGF-A; VPF
Species

Mouse

Source

E. coli

Accession

Q00731 (T29-R214)

Gene ID

22339

Molecular Weight

Approximately 38.8 kDa

AA Sequence

MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Biological Activity
The ED50 is <5 ng/mL as measured by human umbilical vein endothelial cells(HUVEC), corresponding to a specific activity of >2.0 × 105 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water or aqueous buffer containing 0.1% BSA.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Vascular endothelial growth factor (VEGF or VEGFA) is a potent mediator of both angiogenesis and vasculogenesis in the fetus and adult. It is a member of the PDGF family that is characterized by the presence of eight conserved cysteine residues and a cystine knot structure[1]. VEGF165 appears to be the most abundant and potent isoform, followed by VEGF121 and VEGF189[1][2]. VEGF165 binds the semaphorin receptor, Neuropilin1 and promotes complex formation with VEGF R2[3].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VEGF165 Protein, Mouse
Cat. No.:
HY-P7312
Quantity:
MCE Japan Authorized Agent: