VHL Protein, Human (His)
Based on 1 Customer Validation
VHL protein is an important component of the von Hippel-Lindau ubiquitination complex and plays a key role in ubiquitination and proteasomal degradation. As a target recruitment subunit in the E3 ubiquitin ligase complex, VHL specifically recruits hydroxylated hypoxia-inducible factor (HIF) under normoxic conditions and regulates cellular responses to oxygen levels. VHL Protein, Human (His) is the recombinant human-derived VHL protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
VHL protein is an important component of the von Hippel-Lindau ubiquitination complex and plays a key role in ubiquitination and proteasomal degradation. As a target recruitment subunit in the E3 ubiquitin ligase complex, VHL specifically recruits hydroxylated hypoxia-inducible factor (HIF) under normoxic conditions and regulates cellular responses to oxygen levels. VHL Protein, Human (His) is the recombinant human-derived VHL protein, expressed by E. coli , with N-6*His labeled tag.
The VHL Protein plays a pivotal role in the ubiquitination and subsequent proteasomal degradation through the von Hippel-Lindau ubiquitination complex. Functioning as a target recruitment subunit in the E3 ubiquitin ligase complex, VHL specifically recruits hydroxylated hypoxia-inducible factor (HIF) under normoxic conditions. This regulatory mechanism contributes to the modulation of cellular responses to changes in oxygen levels. Additionally, VHL is involved in transcriptional repression through interactions with HIF1A, HIF1AN, and histone deacetylases, further influencing gene expression in response to environmental cues. Notably, VHL exhibits oxygen-responsive ubiquitination activity, targeting ADRB2. Furthermore, it acts as a negative regulator of mTORC1 by promoting the ubiquitination and degradation of RPTOR. The multifaceted roles of VHL underscore its significance in cellular homeostasis, protein modification, and the orchestration of molecular pathways involved in oxygen sensing and response.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P40337 (M1-D213)
-
Molecular Construction
-
N-term
-
6*His
-
VHL (M1-D213)
Accession # P40337 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
VHL; Von Hippel‑Lindau Tumor Suppressor; Von Hippel‑Lindau Disease Tumor Suppressor; VHL1; PVHL; Von Hippel‑Lindau Tumor Suppressor, E3 Ubiquitin Protein Ligase; Protein G7; Von Hippel‑Lindau Tumor Suppressor, Isoform CRA_d; Von Hippel‑Lindau Tumor Suppre
-
AA Sequence
MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
-
Molecular Weight
Approximately 24-34 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
