1. Recombinant Proteins
  2. Others
  3. VHL Protein, Human (His)

VHL Protein, Human (His)

Cat. No.: HY-P76124
COA Handling Instructions

VHL protein is an important component of the von Hippel-Lindau ubiquitination complex and plays a key role in ubiquitination and proteasomal degradation. As a target recruitment subunit in the E3 ubiquitin ligase complex, VHL specifically recruits hydroxylated hypoxia-inducible factor (HIF) under normoxic conditions and regulates cellular responses to oxygen levels. VHL Protein, Human (His) is the recombinant human-derived VHL protein, expressed by E. coli , with N-6*His labeled tag. The total length of VHL Protein, Human (His) is 213 a.a., with molecular weight of ~34 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $155 In-stock
10 μg $265 In-stock
20 μg $450 In-stock
50 μg $810 In-stock
100 μg $1260 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

VHL protein is an important component of the von Hippel-Lindau ubiquitination complex and plays a key role in ubiquitination and proteasomal degradation. As a target recruitment subunit in the E3 ubiquitin ligase complex, VHL specifically recruits hydroxylated hypoxia-inducible factor (HIF) under normoxic conditions and regulates cellular responses to oxygen levels. VHL Protein, Human (His) is the recombinant human-derived VHL protein, expressed by E. coli , with N-6*His labeled tag. The total length of VHL Protein, Human (His) is 213 a.a., with molecular weight of ~34 kDa.

Background

The VHL Protein plays a pivotal role in the ubiquitination and subsequent proteasomal degradation through the von Hippel-Lindau ubiquitination complex. Functioning as a target recruitment subunit in the E3 ubiquitin ligase complex, VHL specifically recruits hydroxylated hypoxia-inducible factor (HIF) under normoxic conditions. This regulatory mechanism contributes to the modulation of cellular responses to changes in oxygen levels. Additionally, VHL is involved in transcriptional repression through interactions with HIF1A, HIF1AN, and histone deacetylases, further influencing gene expression in response to environmental cues. Notably, VHL exhibits oxygen-responsive ubiquitination activity, targeting ADRB2. Furthermore, it acts as a negative regulator of mTORC1 by promoting the ubiquitination and degradation of RPTOR. The multifaceted roles of VHL underscore its significance in cellular homeostasis, protein modification, and the orchestration of molecular pathways involved in oxygen sensing and response.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P40337 (M1-D213)

Gene ID
Molecular Construction
N-term
6*His
VHL (M1-D213)
Accession # P40337
C-term
Synonyms
von Hippel-Lindau disease tumor suppressor; Protein G7; pVHL; VHL
AA Sequence

MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD

Molecular Weight

Approximately 34 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.2 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

VHL Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VHL Protein, Human (His)
Cat. No.:
HY-P76124
Quantity:
MCE Japan Authorized Agent: