1. Recombinant Proteins
  2. Immune Checkpoint Proteins
  3. Inhibitory Checkpoint Molecules
  4. VISTA
  5. VISTA/B7-H5 Protein, Rat (HEK293, Fc)

VISTA/B7-H5 protein, an immunoregulatory receptor, inhibits T-cell response and may regulate embryonic stem cell differentiation by inhibiting BMP4 signaling. It also stimulates MMP14-mediated MMP2 activation, suggesting a role in matrix metalloproteinase processes. These roles highlight the significance of VISTA/B7-H5 in immune regulation, embryonic development, and extracellular matrix dynamics. VISTA/B7-H5 Protein, Rat (HEK293, Fc) is the recombinant rat-derived VISTA/B7-H5 protein, expressed by HEK293 , with C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
500 μg 해외재고보유
1 mg 해외재고보유
> 1 mg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

VISTA/B7-H5 protein, an immunoregulatory receptor, inhibits T-cell response and may regulate embryonic stem cell differentiation by inhibiting BMP4 signaling. It also stimulates MMP14-mediated MMP2 activation, suggesting a role in matrix metalloproteinase processes. These roles highlight the significance of VISTA/B7-H5 in immune regulation, embryonic development, and extracellular matrix dynamics. VISTA/B7-H5 Protein, Rat (HEK293, Fc) is the recombinant rat-derived VISTA/B7-H5 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

VISTA/B7-H5 protein, functioning as an immunoregulatory receptor, plays a pivotal role in inhibiting the T-cell response, as established in various studies. Additionally, it may contribute to the differentiation of embryonic stem cells by inhibiting BMP4 signaling, showcasing its potential role in developmental processes. Moreover, VISTA/B7-H5 has been implicated in stimulating MMP14-mediated MMP2 activation, suggesting a regulatory function in matrix metalloproteinase-mediated processes. This multifaceted role underscores the significance of VISTA/B7-H5 in immune regulation, embryonic development, and extracellular matrix dynamics, revealing its potential impact across diverse biological contexts.

Biological Activity

Measured by its ability to inhibit anti-CD3 antibody induced IL-2 secretion in Jurkat human T lymphocytes. The ED50 for this effect is 1.173 μg/mL in the presence of 5 μg/mL anti-CD3, corresponding to a specific activity is 852.515 U/mg.

Species

Rat

Source

HEK293

Tag

C-hFc

Accession

G3V9P3 (I14-A172)

Gene ID
Molecular Construction
N-term
VISTA (I14-A172)
Accession # G3V9P3
hFc
C-term
Protein Length

Partial

Synonyms
Platelet receptor Gi24; Stress-induced secreted protein-1; Sisp-1; C10orf54; SISP1
AA Sequence

IKVTTPYSLYVCPEGQNVTLTCRILDSVSKGHDANFLKTWFLSSRGEVQVCKEHRPIRNFISHHQHHRSHPAVNASHDQPQKHGLEIAYDNHGNFSITLHNVTLSDSGLYCCLVIEVKHHHPERRLYGYMELQVQTGKGSASTCTAYPPNEQDSDSITA

Predicted Molecular Mass
44 kDa
분자량

Approximately 60-75 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
References

VISTA/B7-H5 Protein, Rat (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

VISTA/B7-H5 Protein, Rat (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
VISTA/B7-H5 Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P73546
수량:
MCE Japan Authorized Agent: