1. Recombinant Proteins
  2. Others
  3. Vitamin D-binding protein/GC Protein, Human (HEK293, His)

Vitamin D-binding protein/GC Protein, Human (HEK293, His)

Cat. No.: HY-P71068
COA Handling Instructions

GC protein is a multifunctional protein that promotes vitamin D transport and storage while scavenging extracellular G-actin to maintain cellular homeostasis. It enhances the chemotactic activity of C5 alpha toward neutrophils during inflammation, helps macrophage activation, and interacts with B lymphocyte and T lymphocyte membranes, indicating its involvement in the immune process. Vitamin D-binding protein/GC Protein, Human (HEK293, His) is the recombinant human-derived Vitamin D-binding protein/GC protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Vitamin D-binding protein/GC Protein, Human (HEK293, His) is 458 a.a., with molecular weight of ~53.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $120 In-stock
50 μg $360 Get quote
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GC protein is a multifunctional protein that promotes vitamin D transport and storage while scavenging extracellular G-actin to maintain cellular homeostasis. It enhances the chemotactic activity of C5 alpha toward neutrophils during inflammation, helps macrophage activation, and interacts with B lymphocyte and T lymphocyte membranes, indicating its involvement in the immune process. Vitamin D-binding protein/GC Protein, Human (HEK293, His) is the recombinant human-derived Vitamin D-binding protein/GC protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Vitamin D-binding protein/GC Protein, Human (HEK293, His) is 458 a.a., with molecular weight of ~53.0 kDa.

Background

Vitamin D-binding protein (GC Protein) is a multifunctional protein engaged in various physiological processes. It plays a pivotal role in the transport and storage of vitamin D, contributing to its systemic availability. Furthermore, GC Protein acts as a scavenger for extracellular G-actin, a crucial function in maintaining cellular homeostasis. In the context of inflammation, it enhances the chemotactic activity of C5 alpha for neutrophils, actively participating in immune responses. Additionally, GC Protein is implicated in macrophage activation, contributing to the orchestration of immune processes. Beyond its immune-related functions, GC Protein associates with membrane-bound immunoglobulin on B-lymphocytes and interacts with the IgG Fc receptor on T-lymphocyte membranes, suggesting its involvement in immune cell interactions. Notably, the interaction with LRP2 is essential for the renal uptake of GC in complex with 25-hydroxyvitamin D3, highlighting its significance in vitamin D metabolism and homeostasis.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P02774 (L17-L474)

Gene ID
Molecular Construction
N-term
(L17-L474)
Accession # P02774
6*His
C-term
Synonyms
Vitamin D-Binding Protein; DBP; VDB; Gc-Globulin; Group-Specific Component; GC
AA Sequence

LERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL

Molecular Weight

Approximately 53.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Vitamin D-binding protein/GC Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Vitamin D-binding protein/GC Protein, Human (HEK293, His)
Cat. No.:
HY-P71068
Quantity:
MCE Japan Authorized Agent: