1. Recombinant Proteins
  2. Others
  3. Vitamin D-binding protein/GC Protein, Human (P.pastoris, His-SUMOstar)

Vitamin D-binding protein/GC Protein, Human (P.pastoris, His-SUMOstar)

Cat. No.: HY-P71736
Handling Instructions

GC protein is a multifunctional protein that promotes vitamin D transport and storage while scavenging extracellular G-actin to maintain cellular homeostasis. It enhances the chemotactic activity of C5 alpha toward neutrophils during inflammation, helps macrophage activation, and interacts with B lymphocyte and T lymphocyte membranes, indicating its involvement in the immune process. Vitamin D-binding protein/GC Protein, Human (P.pastoris, His-SUMOstar) is the recombinant human-derived Vitamin D-binding protein/GC protein, expressed by P. pastoris , with N-6*His, N-SUMOstar labeled tag. The total length of Vitamin D-binding protein/GC Protein, Human (P.pastoris, His-SUMOstar) is 456 a.a., with molecular weight of ~67.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GC protein is a multifunctional protein that promotes vitamin D transport and storage while scavenging extracellular G-actin to maintain cellular homeostasis. It enhances the chemotactic activity of C5 alpha toward neutrophils during inflammation, helps macrophage activation, and interacts with B lymphocyte and T lymphocyte membranes, indicating its involvement in the immune process. Vitamin D-binding protein/GC Protein, Human (P.pastoris, His-SUMOstar) is the recombinant human-derived Vitamin D-binding protein/GC protein, expressed by P. pastoris , with N-6*His, N-SUMOstar labeled tag. The total length of Vitamin D-binding protein/GC Protein, Human (P.pastoris, His-SUMOstar) is 456 a.a., with molecular weight of ~67.0 kDa.

Background

Vitamin D-binding protein (GC Protein) is a multifunctional protein engaged in various physiological processes. It plays a pivotal role in the transport and storage of vitamin D, contributing to its systemic availability. Furthermore, GC Protein acts as a scavenger for extracellular G-actin, a crucial function in maintaining cellular homeostasis. In the context of inflammation, it enhances the chemotactic activity of C5 alpha for neutrophils, actively participating in immune responses. Additionally, GC Protein is implicated in macrophage activation, contributing to the orchestration of immune processes. Beyond its immune-related functions, GC Protein associates with membrane-bound immunoglobulin on B-lymphocytes and interacts with the IgG Fc receptor on T-lymphocyte membranes, suggesting its involvement in immune cell interactions. Notably, the interaction with LRP2 is essential for the renal uptake of GC in complex with 25-hydroxyvitamin D3, highlighting its significance in vitamin D metabolism and homeostasis.

Species

Human

Source

P. pastoris

Tag

N-6*His;N-SUMOstar

Accession

P02774 (R19-L474)

Gene ID
Molecular Construction
N-term
6*His-SUMOstar
GC (R19-L474)
Accession # P02774
C-term
Synonyms
DBP; DBP/GC; Gc globulin; Gc-globulin; GRD3; Group specific component; Group specific component vitamin D binding protein; Group-specific component; hDBP; VDB
AA Sequence

RGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL

Molecular Weight

Approximately 67.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Vitamin D-binding protein/GC Protein, Human (P.pastoris, His-SUMOstar) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Vitamin D-binding protein/GC Protein, Human (P.pastoris, His-SUMOstar)
Cat. No.:
HY-P71736
Quantity:
MCE Japan Authorized Agent: