VNN1/Vanin-1 Protein, Mouse (HEK293, Fc)

Vanin-1 (VNN1) is an amide hydrolase that specifically hydrolyzes one carbon amide bond in D-panthionine.The function of this enzyme is essential for recycling pantothenic acid (vitamin B5) and releasing cysteamine.VNN1/Vanin-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived VNN1/Vanin-1 protein, expressed by HEK293 , with C-hFc labeled tag.

Vanin-1 (VNN1) is an amidohydrolase with the specific function of hydrolyzing one of the carboamide linkages in D-pantetheine. This enzymatic activity plays a crucial role in the recycling of pantothenic acid (vitamin B5), ultimately releasing cysteamine. By facilitating the breakdown of D-pantetheine, VNN1 contributes to the metabolic processes involved in maintaining adequate levels of pantothenic acid, a vital component in various biochemical pathways. This enzymatic action underscores the significance of VNN1 in the regulation of vitamin B5 homeostasis and the release of cysteamine, highlighting its role in cellular metabolism.

Mouse

HEK293

C-hFc

Q9Z0K8 (M1-S487)

22361  [NCBI]

Partial

MGMSWWLACAAAFSALCVLKASSLDTFLAAVYEHAVILPKDTLLPVSHSEALALMNQNLDLLEGAIVSAAKQGAHIIVTPEDGIYGVRFTRDTIYPYLEEIPDPQVNWIPCDNPKRFGSTPVQERLSCLAKNNSIYVVANMGDKKPCNTSDSHCPPDGRFQYNTDVVFDSQGKLVARYHKQNIFMGEDQFNVPMEPEFVTFDTPFGKFGVFTCFDILFHDPAVTLVTEFQVDTILFPTAWMDVLPHLAAIEFHSAWAMGMGVNFLAANLHNPSRRMTGSGIYAPDSPRVFHYDRKTQEGKLLFAQLKSHPIHSPVNWTSYASSVESTPTKTQEFQSIVFFDEFTFVELKGIKGNYTVCQNDLCCHLSYQMSEKRADEVYAFGAFDGLHTVEGQYYLQICILLKCKTTNLRTCGSSVDTAFTRFEMFSLSGTFGTRYVFPEVLLSEVKLAPGEFQVSSDGRLVSLKPTSGPVLTIGLFGRLYGKDWAS

Approximately 85-90 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.